CAZyme Information: FPRO_08111-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_08111-t41_1-p1
• CAZy Family: GH154
• CAZyme Description: related to alpha-mannosidase IC (MNSIC)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		67500.81	6.3112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000007:233965-235774(+)

Full Sequence      

MLATFQGRPGRRYISLFLFIAITWFLIHNFRPYERYRTVRIGTYNYLPSSYDWSKQQVFH
PVEDIKSPPNGTFKLLPRIQKERTEDYKEDSETTARKAAIKQAFTKSWEAYKKHAWGWDE
LAPVSLRGKTTFSGWAAQIVDALDTLWILDMKDEFREAVKVVAMIDWSRTGDEYLNLFEV
AIRHLGGLLSAYELSDEAVLLGKAIELGEMLYAAFDTPNRLPSHWLYFKAAKSGSQQADA
SMSGAAGGSMCLEFTRLSQITGNPKYYDATERIKQFFYRNQDKTKIPGLWPHVMNYRDEK
VDEARFTLGAGADSLYEYLPKMHALLGGLDSEYVEMTTKALDTAVKHILYKPRNPEDLDI
LMSGNVLAGEEGSKPELTAEMQHLTCFVGGTYALAGKLLSWSDFVDLGSRLTAGCVWAYD
AFPTNIMPEIAQLEACESITSKCRWSDKPVEKKDKLPEGFIRVRNSEYRLRPEAIESVFY
MWRITGDDVWRTAAWRMWEGIVKQTETQEAFATISDVNRKGSDKRDNMETFWMSETIKYF
YLTFDDPNVINLDEWVLNTEAHPLRRPKGEEVEVPKKKTTWWKFGH

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	103	566	9.3e-155	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	103	566	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.58e-109	85	568	60	520	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	4.88e-04	83	290	370	582	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
271200	LanM-like	0.004	185	276	598	682	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI95552.1|GH47	0.0	1	586	1	586
CCT68723.1|GH47	0.0	1	586	1	586
QGI64666.1|GH47	0.0	1	586	1	586
QGI81928.1|GH47	0.0	1	586	1	586
QKD54609.1|GH47	0.0	1	581	1	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	2.20e-71	95	564	4	471	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	3.84e-71	89	564	33	506	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	2.06e-67	96	564	5	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.39e-67	96	564	10	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.52e-67	96	564	10	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2ULB2|MNS1B_ASPOR	1.76e-72	95	565	39	507	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.76e-72	95	565	39	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|D4AV26|MNS1B_ARTBC	6.59e-72	99	565	43	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|A1CP08|MNS1B_ASPCL	1.89e-71	89	565	28	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|E9CXX8|MNS1B_COCPS	4.50e-71	76	565	23	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000001

TMHMM  Annotations     

Start	End
13	30