CAZyme Information: FPRO_08092-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_08092-t41_1-p1
• CAZy Family: PL1
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	FJOF01000007|CGC11	84366.27	4.9221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000007:305322-307726(+)

Full Sequence      

MGLHLSSAWSTPRGWRLITVTLVALTLLLVVPLHRLSDDSPGVYGHLTNYLSHEGAAYDV
EEGFVANLNETTTNQILNDKEPAEKNPYDTDSPQYTGEKDKEASASAEKPAGAQHPEDDK
KAEDAEDDGAVLEIDHGDSDTPQSTDQIHSEVPKETTKPESSETESQAVQSGEPKSQEDG
NKPEEADKEHRPQDNTQPQTGEKKLQADEKASGDEHKPPHSEIKTEESENKHQQGDDKAE
DKDKGDKQPDGTKLSDQSQNNNDHKNEDGDSATTSIASEFMPSQTADLDVPSGPLSNWTG
VCDGFPNTDGIMLVMKTGATEAFTKLPAHLLTSLQCLDDYLLFSDLDQQIDKYQIYDVLK
DVKDDVKKGRKEFDLYKAQTECPIAQQYCTENMKEGWNLDKYKFLHMVEKAWEMRPNKEW
YVFAEADTYVFWSNLVWYLRNRVNGTETPYVGSVAMLKGKPFAHGGSGYVIHGDTMRKMV
EIPDLAHKYDMMATHECCGDYLMSLAVMETGKKVKQAHPMFNGEKPMTLPFGNNHWCEPL
LSMHHMNPEEVSDAWHFEKTRQKKGFIQIREMYHQFWAPQLEAEHDEWDNLSDDVCYIGF
GPEAQGKATDHQKGRQKKENEKNAIEQHAHRSKEHCAMVCEAENLDISEDDYYNLKDDKE
RNEMIRSRYSQKKGNKEWHAGRRCFQWRYHNNVCCIARSFKRGKPRKEQKPEEKWTSGWF
VQGINDWIDAKGDCTPKWKD

Enzyme Prediction     

No EC number prediction in FPRO_08092-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
115071	NESP55	1.03e-07	99	265	69	233	Neuroendocrine-specific golgi protein P55 (NESP55). This family consists of several mammalian neuroendocrine-specific golgi protein P55 (NESP55) sequences. NESP55 is a novel member of the chromogranin family and is a soluble, acidic, heat-stable secretory protein that is expressed exclusively in endocrine and nervous tissues, although less widely than chromogranins.
273344	2A1904	3.99e-07	89	304	634	831	K+-dependent Na+/Ca+ exchanger. [Transport and binding proteins, Cations and iron carrying compounds]
227596	MDN1	5.75e-06	61	272	3805	4023	Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal structure and biogenesis].
411414	MSCRAMM_ClfB	1.76e-05	79	275	575	772	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
223003	PHA03169	8.61e-05	79	267	104	285	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT68705.1|GT31	0.0	1	740	1	750
QGI95534.1|GT31	0.0	1	740	1	750
QGI81910.1|GT31	0.0	1	740	1	750
QGI64648.1|GT31	0.0	1	740	1	750
QKD54589.1|GT31	0.0	1	740	1	748

PDB Hits     

FPRO_08092-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_08092-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FPRO_08092-t41_1-p1.