CAZyme Information: FPRO_07260-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_07260-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: related to 4-cresol dehydrogenase flavoprotein subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563	FJOF01000007|CGC9	62611.70	6.0546

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000007:2650138-2652036(-)

Full Sequence      

MTTVNPLVLPPGIAPSVFHQFISEVTEVTTAENVIIISNPDQLDKQDYRDPSKMHDMFDI
TSKQHFVSSAVVTPRDVAEVQAIVKLCNKFEIPLWPFSIGRNVGYGGAAPRVPGSIGLDL
GKHMNKILKVDVDGAYALVEPGVTYADLHQYLVDNNLRDKLWIDVPDLGGGSVLGNTTER
GVGYTPYGDHFMMHCGMEVVLPDGTLVRTGMGALPNPDADPNAPPHEQEPNSAWQLFNYG
FGPYNDGIFTQSSLGIVVKMGIWLMVNPGGYQSYLITIPKDEDLHQAIEIIRPLRTSMVL
QNVPTVRHVLLDAAVMGSRDKYTTSKKPLNDKELDEIAEKLNLGRWNFYGALYGPEPIRK
VMWEVVKGAFSAIPGAKFYFPEDMPDNLVLQTRHLTLQGIPTMTELEWVNWLPNGAHLFF
SPIAKVTGDDAIAQYALTRKRCEEAGFDFIGTFVVGMREMHHIVCLVFDRLDPESCRRAH
NLIIQLIDDAAKKGWGEYRTHLALMDQIAQTYNFNNNAQMHLNTTIKNALDPKGILAPGK
NGIWPSGYNAKDFAVSPQRSTKL

Enzyme Prediction     

EC	1.1.3.38:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	6	552	4.3e-251	0.9942528735632183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	4.32e-31	69	210	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	5.50e-24	67	541	31	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].
397178	FAD-oxidase_C	9.58e-12	420	540	129	247	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.
178402	PLN02805	9.38e-10	67	213	133	274	D-lactate dehydrogenase [cytochrome]
183043	PRK11230	3.16e-05	71	143	59	128	glycolate oxidase subunit GlcD; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI94813.1|AA4	0.0	1	563	1	563
QGI63931.1|AA4	0.0	1	563	1	563
QGI81201.1|AA4	0.0	1	563	1	563
CCT67978.1|AA4	0.0	1	563	1	563
AFJ11909.1|AA4	0.0	1	563	1	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E8F_A	1.32e-271	5	549	8	554	Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8F_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8G_A STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8G_B STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8H_A Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum],1E8H_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum]
1DZN_A	7.58e-271	5	549	8	554	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1W1K_A	1.08e-270	5	549	8	554	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1AHU_A	1.53e-270	5	549	8	554	Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]
1QLT_A	3.07e-270	5	549	8	554	STRUCTURE OF THE H422A MUTANT OF THE FLAVOENZYME VANILLYL-ALCOHOL OXIDASE [Penicillium simplicissimum],1QLT_B STRUCTURE OF THE H422A MUTANT OF THE FLAVOENZYME VANILLYL-ALCOHOL OXIDASE [Penicillium simplicissimum],1QLU_A Structure Of The H422a Mutant Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],1QLU_B Structure Of The H422a Mutant Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	7.85e-270	5	549	8	554	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	2.38e-120	1	543	1	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P94535|GLCD_BACSU	1.99e-13	32	210	8	180	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
sp|F1QXM5|LDHD_DANRE	3.82e-13	71	379	73	368	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
sp|Q86WU2|LDHD_HUMAN	3.54e-11	70	323	68	314	Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=LDHD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000002

TMHMM  Annotations     

There is no transmembrane helices in FPRO_07260-t41_1-p1.