CAZyme Information: FPRO_06921-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_06921-t41_1-p1
• CAZy Family: GH114
• CAZyme Description: related to alpha-galactosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59377.70	4.6853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000003:733058-734876(-)

Full Sequence      

MASLVFASLLASAYGKTVKSPTPPMGWNSYNHYNCRPSEEIIKINAKGLVDLGFKDLGYS
IVTVDCGWPSRDRDSEGRLQWNETLFPSGPKALGEYIHDLGLEFGLYSGAGYLQCGSTDI
PASLDYEEIDAKSFAEWGGDTLKYDNCYATSKTNMVDATSAEAKSPNRFIKMAAAINETD
RDIKYFLCQWGIGEDVPQWAAPLGNAWRMSNDIFNAWRAIWRITNQVVAHAKYNGPGAFA
DMDMLIIGLGALSHDEERFHFGFWSMMKSPLIIGGVMDAKQIPAESLEIMSNKEVIAINQ
DPLAEATKLVIRYTEEEWDVWAGNLSSNRQVLGVLNWKNETQTVKVDLSLIGVDKAAARD
VWAHEDLSISGIQEFKLAPHELRQLVLSDISPASLPKAAGYYSAQDATLSGSASLVNCKD
TECLPTHKKVGSIGSDAKVTFESVSAAKDGPAYLGIDYINHEYHHTIGDWETNSRNMSIS
VNGQDAKRWAFPNAGGDWFESDRLRILVDGFKKGDNNTVAFTASASGGWAPDLVGFEVLE

Enzyme Prediction     

EC	3.2.1.22:1	3.2.1.88:1	3.2.1.22:1	3.2.1.88:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	121	367	3.3e-67	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	1.69e-117	23	301	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
177874	PLN02229	9.94e-93	22	391	62	421	alpha-galactosidase
166449	PLN02808	6.47e-92	22	388	31	384	alpha-galactosidase
178295	PLN02692	2.90e-91	22	367	55	386	alpha-galactosidase
374582	Melibiase_2	3.50e-70	22	301	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61559.1|CBM35|GH27	0.0	1	540	29	568
BAH10648.1|CBM35|GH27|3.2.1.22|3.2.1.88	0.0	1	540	1	540
CZS85789.1|CBM35|GH27	0.0	1	539	25	566
CEI70486.1|CBM35|GH27	0.0	1	539	1	542
QPC62824.1|CBM35|GH27	0.0	1	539	25	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAS_A	1.25e-84	22	388	8	360	Chain A, alpha-galactosidase [Oryza sativa]
6F4C_B	1.85e-72	22	388	8	361	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3A5V_A	4.56e-68	22	394	8	397	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
4OGZ_A	4.41e-59	22	336	99	419	Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343],4OGZ_B Crystal structure of a putative alpha-galactosidase/melibiase (BF4189) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution [Bacteroides fragilis NCTC 9343]
1SZN_A	4.86e-56	18	381	7	404	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AX28|AGALD_EMENI	1.40e-127	22	540	32	659	Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2
sp|A4DA70|AGALD_ASPFU	1.11e-123	22	540	30	648	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglD PE=3 SV=2
sp|B0YEK2|AGALD_ASPFC	1.11e-123	22	540	30	648	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aglD PE=3 SV=2
sp|A1D9S3|AGALD_NEOFI	1.92e-121	22	540	30	648	Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglD PE=3 SV=1
sp|Q2UI87|AGALD_ASPOR	1.32e-117	4	539	5	657	Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000376	0.999604	CS pos: 15-16. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in FPRO_06921-t41_1-p1.