CAZyme Information: FPRO_06674-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_06674-t41_1-p1
• CAZy Family: GH1
• CAZyme Description: related to Versicolorin B synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	FJOF01000003|CGC26	65227.68	4.8599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000003:1289235-1291434(+)

Full Sequence      

MRFAITSVLLLSQVSSITARDDHESTLSSTYDFVIVGGGTTGLILADRLSESGDQKVLVL
EAGSDPNVVAMHQAPGAVEYIAGTAIDWNFYTEPQEGLDGRKLAYHRGRGLGGSSILNGL
YYGRGSANVYDHWVELGNPGWSWEDVYPSFIKSTHFNAPNNGTGYNQRYQTWDPSAYSNG
PLEIGYQGYVPPSSIAFIDACAAVNIPIVPDLNNGKNVGVKQGTATLTSKYRRSSAYDYY
KAASKRPNVDILHNAPVQQIIFSKNATGFPVATGVNFIDHSQGRHRTATASKEIVVTLGT
FQSPQMLMVSGIGPEATLDAFNIEPVVINENVGQHMMDHNLYSISATVVPEASTHQLMFN
STAVEASQEEYYTTGKGVYTAPGGITNGFQELSNTQLRNIGAEAVVDAGLTNRSTVEFLF
ESFFYPNSPGPTYEPSSDSSYISISVSSMVALSKGNITIQSSGMSDAPIINPNYYTHPAD
RAIAINAFRDARKILAHSAFANLTVGPNHGEVAPGVSNVASDDDEAIFEYIKATTVPNWH
ASGTNRMLPLEDGGVVDSRLRVYGVQGLRVIDSSIMPTVPDVNIAGPVYMLGEHGATMIK
EDWDI

Enzyme Prediction     

No EC number prediction in FPRO_06674-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	30	602	1.5e-167	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.38e-100	25	602	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.26e-91	28	600	3	532	choline dehydrogenase; Validated
274888	Rv0697	1.94e-59	32	599	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.06e-41	453	594	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.68e-37	29	599	54	576	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67729.1|AA3_2	0.0	1	605	1	605
QGI81035.1|AA3_2	0.0	1	605	1	605
QGI63763.1|AA3_2	0.0	1	605	1	605
QGI94646.1|AA3_2	0.0	1	605	1	605
QSS67839.1|AA3_2	5.78e-260	5	603	15	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.38e-73	31	602	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.35e-73	31	602	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	6.66e-69	28	602	3	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.90e-60	29	602	4	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	9.00e-60	5	604	13	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	4.26e-79	3	601	13	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	2.47e-77	28	600	48	625	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	4.82e-77	4	600	16	625	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|P0DO29|ERIK_HERER	2.23e-70	5	600	8	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	2.77e-70	32	599	4	525	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001058	0.998909	CS pos: 19-20. Pr: 0.9709

TMHMM  Annotations     

There is no transmembrane helices in FPRO_06674-t41_1-p1.