CAZyme Information: FPRO_06613-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_06613-t41_1-p1
• CAZy Family: CE8|CE8|CE8|CE8|CE8
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1436		157459.51	4.8003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000003:1439247-1444473(-)

Full Sequence      

MQRLRYALALFAAAGSAVARPSLINFGSMSMNNIFGRETTDFFNPDDLTFIKKLAAVGDS
YSAGIGAGDGLHGEGDENCRRYDHSYPYLINQDERLGDTANRKFQFKSCSGAVIKNVIED
QLPSIDSDQQIILLSAGGNDAELVNILNQCVYQWFALNDQHSTVGKVAEMKGEPWAKGWD
WDAASRGCLGQLQYSKNIINTDEFSKRIDSMIEATKKKLSSDGMIYYTGYAKFWSTDYGS
ACDKVSWSTWIFKSYNIWQPATRLEELRRREMNRLVDLINDKIEAAVKRAGDKVTFINYD
EYVGHFKGRYCEDGVDESVVDSNTRPELMFYELDTFDPWGNRPWKRSTVEHTNGSFSGDM
NTMARAAEFVAPDVTFRQEHKIEDDSEIQGLQAAAKEGATEDVPNLLPDGYGRVFHPQIL
LHELIANLVLFEVSNRRMEENNMAPEPLLDTSVAQCPINPSGNIVLKYKETEPGEAVKKG
TELRILPVGDSITVGYLSDRKGGDGNGYRGQLKKDLSGDKVVFAGTESSGTMSDGNYAAW
SGKTIQYISDHADPSLKQRPNIILLAAGTNDMNPNRGISKEGNDPKGAADRLGKLIDKMV
KACPDATILVAMIINTCDEKQSPATKEFQKLVPGVVKSRHDDGQHVLAVDFTTFKTSDLQ
DCIHPTNDGYKLMGDYWYSFIHQIPTSWIKKPVGPDPNGGDGTNGGIDKNIPAPDWGKSP
IQVTSKKTVADAAEYATGGKDKCVICNGNPWYKGTGKIAQGGVGKNGDWQYHKDWKAEGE
VAEGLGLDNQYVRLHDMNGDGKADYVWIHPKTGEITCWLNNLPKPWSKAGNNNGIIGSGV
GPAKTIYLADMNGDGMDDYLVVDPDNGSVRVWWNYGPDDSWDNGWKFVPGGEIASGVPHA
NLETLRFPDINGDGRADYVYIGEGGSLKHHLNTGSVGGRDVLFHAMGGIATGAVSDISKL
VFADVNGDGRDDYLIWDEEGGLTGFLNQPTNREGVPLFVNQGPAKTIADGIKKKPSTIRL
ADMDGDGKDDYVYVGDHGALSVWYNRGTTDDSMAIDSLRFADMDGDGVDDYVWLDPKTGA
LTVYLNSGVNDGDSLGWAWSPINGGKPIASGAAPANQVVFGDINGDGLDDYLDLDPKTGL
LKAYLNLGRESEWKFRPIGTIASGLGPGKRVRIADIDGDGRDDYIFLKDNGGTTIYRNIY
GPDNDGDKYAPMSDADASGINQSPDEIDFIDMNGDGKADYVWTSRLDGSVKVWYNDYPKK
PTWREAGEIAGGVGTSGANIRYAKLQKTGRYDYVAVDPKTGAIAAWLNGCGDPDTSKKKH
RITIARYLTTVWVIAEKPEDKEFSSDTCFKTGKNGDTRGTPILNTTADDKFPAALKSGDT
MEKLYGHTCFYEGSTDRVGKLVCDGVSGIRCYKDENFGKTQKCRFGSYTYALYCEW

Enzyme Prediction     

No EC number prediction in FPRO_06613-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	483	681	4.4e-48	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.35e-50	483	681	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238861	SEST_like	1.19e-30	52	329	1	238	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
404371	Lipase_GDSL_2	8.60e-16	488	672	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.23e-11	485	680	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	2.76e-08	485	677	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67685.1|CE0	0.0	1	1436	1	1436
QGI80975.1|CE0	0.0	1	1436	1	1437
UMZ45332.1|CE0	0.0	3	1436	5	1455
QPC64279.1|CE0	0.0	451	1436	16	844
UQC90643.1|CE0	0.0	466	1417	342	1309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HYQ_A	3.24e-12	56	153	7	97	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]
5MAL_A	7.50e-09	56	153	6	96	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]
6SUP_A	4.53e-08	848	1046	422	606	Crystal Structure of TcdB2-TccC3-Cdc42 [Photorhabdus luminescens]
6H6G_A	4.54e-08	848	1046	453	637	Crystal Structure of TcdB2-TccC3 without hypervariable C-terminal region [Photorhabdus luminescens]
4O9X_A	4.55e-08	848	1046	487	671	Crystal Structure of TcdB2-TccC3 [Photorhabdus luminescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9S2A5|LIP1_STRCO	2.30e-09	56	153	40	130	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	5.57e-09	12	153	8	130	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999677	CS pos: 19-20. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in FPRO_06613-t41_1-p1.