CAZyme Information: FPRO_05588-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_05588-t41_1-p1
• CAZy Family: PL4
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	FJOF01000003|CGC19	49837.00	6.1930

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000003:4264137-4265591(+)

Full Sequence      

MRVFLIQTAKGLFSSSGGYKANHALLRYLASRGHCVRQLCYSYRGEVESYMDRSDEVDTR
FRKGVFHMRSDSDKPGQDVQVHELCMEDGVETLALDSEGFDAAFGGKVESPNQLARMSAE
YIENGTSSAPLMDFISFLQEEIRRFSPTHIISNDGLSMKASLAPELAHLTMSRIAVVHTA
EQLPFGPFAGGLPGHSSTTREADLFQQLDGIWSVSETIRKYALEHGQLETRFLVHHPWTY
MGGKDHVIPDRVFNWDKKFVGMINPCPVKGASILVNLARKCPQLEFLTYMSWGADDATVK
EIKELSNMTVRPCCAVEKDLWRDIKVLVVPSLWCEAWGMVVVEAHLRGIPVVSSNAGALS
ESMLGLDYIMPVTPITGERDASGRYTIPEQDVVPWVKVITKLMQDRSEYERVSATVRDAT
IKWLKGNSEADIETWLMSMRTGSKI

Enzyme Prediction     

No EC number prediction in FPRO_05588-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340850	GT4_ExpE7-like	1.57e-17	137	417	87	339	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
340831	GT4_PimA-like	8.49e-11	76	414	15	342	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	8.18e-10	149	422	88	359	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
404563	Glyco_trans_1_4	6.02e-07	259	405	6	138	Glycosyl transferases group 1.
340816	Glycosyltransferase_GTB-type	9.20e-07	233	361	83	224	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50346.1|GT4	3.61e-279	1	445	1	448
CAE6996711.1|GT4	8.00e-195	1	439	30	471
CAE85589.1|GT4	6.10e-111	1	441	24	461
AEO63904.1|GT4	4.33e-110	1	439	2	410
AEO58675.1|GT4	8.66e-109	1	439	12	417

PDB Hits     

FPRO_05588-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_05588-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRO_05588-t41_1-p1.