CAZyme Information: FPRO_05374-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_05374-t41_1-p1
• CAZy Family: CE12
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565		63247.70	7.4612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000004:3653982-3656076(+)

Full Sequence      

MSKRRGLLKFKFDTLPPGAVRPTGWLKDQLQLSADGLAGHLFEFYRYVSRSTWLGGDWEY
SELNEASPYWFNYIVPLAWSLDDAKLKSQAKAYLDYVLDHQAEDGWLGPETTRQTRGIWA
RSLLLFGLTFFVEGVFPKGGTGTFKTSGFTHGVNLAQGLRYPTVLYRLTGNDSLVHQTKA
AVDMTVKYQTSVSGTIIGDEHLGALSPQRGSELCMAVESIFSYAFLYRFHGDNSYADKAE
LAAFNAFPAAMSPDWWSHQYVTQTNQIRSGNLTQNPFFNVVSYANTYGLEPNFPCCTVNH
PQAYAKYVASSYAKINESSVAHILLGPTSVETHIKGKKVKVKCETSYPFDSILKYTIESK
TKFDFAVRIPGWTTPKANIEMNGGRSKTVAPDDSGLHHTTILPGITTLTLELPMEVRVAT
RNSSASIYYGPLLYAFDIPYTETHHQPLNWTDRKPLPDDEVHPHSHDYVLEPTEIWQYAI
DPHSIVVKTSTSTVKNLPNPIFAKDAPPVFLTVDAWKIAWPTDNDTAAWPPINPVVDKDK
KEKIKLVPFGSAKLHIAQFPVAKSQ

Enzyme Prediction     

No EC number prediction in FPRO_05374-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	165	435	2.7e-23	0.5248508946322068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	5.65e-19	153	435	226	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	2.15e-15	165	445	240	511	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1|CBM66	2.82e-56	12	561	40	647
QNR86060.1|CBM66	1.43e-48	15	561	41	647
QDW25584.1|CBM66	1.07e-46	15	561	43	649
BCB91225.1|CBM13	7.18e-46	2	560	27	639
ARS39276.1|CBM66	9.02e-46	15	561	41	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.17e-08	211	437	332	562	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.86e-07	211	383	332	500	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

FPRO_05374-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRO_05374-t41_1-p1.