CAZyme Information: FPRO_05346-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_05346-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: probable rhamnogalacturonase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	FJOF01000004|CGC6	52760.20	5.9402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000004:3589459-3591233(+)

Full Sequence      

MKLVLFSGLLSAFLANAQLTGPVGPLTALSQKTHECNILDYGAVNDNSTDIADAIEKTFK
TCVLPHTGSRLIVPDGQYLIKRSVVLSNGTNWAFQLDGLITLAYGGNWTVDRKLVLQGFA
GVELLNATINGEGDGQFLQNGLTIINPVDFEFYSQNGKGAIQGQGYIYRNLANTFRPRLV
RIISPINTSVHDLILVDSPKFHIVFDFAENLEVYHLTIRGANLGSYDGVDVVGTNYWIHD
IEVTNRDECVSVKSPSNHALIENLVCNQAGSGISIGSLNVSASIANIHARNINIIQGNNI
AFIKTYPGGSGHVTNITFENFRSKASLYGLDINQYWQNTFEPDTGAVALSNLVFKNFSGS
VADGSKRPPLFLVANDLSFATNVTVQDFSIWTESGTSVINKISNIFGHGDNSYGQANGIK
SLSSGQAPTAYTSTYTVTATPTGWTAPSFPTWAAVSTGYGTDVPIPVYTPAALWKPSGDY
DKHYWGSF

Enzyme Prediction     

No EC number prediction in FPRO_05346-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	149	396	2e-47	0.7353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.00e-19	159	404	61	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	1.11e-16	40	362	57	369	Probable polygalacturonase
177865	PLN02218	2.17e-16	37	362	69	383	polygalacturonase ADPG
215540	PLN03010	2.04e-15	37	412	48	396	polygalacturonase
227721	Pgu1	7.75e-15	37	320	84	392	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50641.1|GH28	0.0	1	488	1	488
QGI79884.1|GH28	0.0	1	488	1	488
QGI93610.1|GH28	0.0	1	488	1	488
QGI62718.1|GH28	0.0	1	488	1	488
CCT66526.1|GH28	0.0	1	488	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.12e-98	18	466	1	404	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	1.76e-08	82	386	40	368	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]
1CZF_A	3.93e-08	217	365	173	322	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYE5|RHGA_ASPNC	2.16e-101	10	476	11	431	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	6.08e-101	10	476	11	431	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|B8NKB9|RHGE_ASPFN	2.33e-98	4	476	8	437	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q00001|RHGA_ASPAC	2.51e-98	14	466	15	422	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	4.52e-98	2	476	5	430	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999728	CS pos: 17-18. Pr: 0.9841

TMHMM  Annotations     

There is no transmembrane helices in FPRO_05346-t41_1-p1.