CAZyme Information: FPRO_04143-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_04143-t41_1-p1
• CAZy Family: CBM18|CBM18|CBM18
• CAZyme Description: probable alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	FJOF01000014|CGC2	75596.50	6.8541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000014:146760-149208(+)

Full Sequence      

MATPNSYANSLGVLPEEFDIIVCGGGSCGCVVAGRLANLDHNLKVLLIEAGESNLNNPWV
FRPGIYPRNMKLDSKTASFYKSRPSKWLAGRSATVPCAHILGGGSSINFMMYTRASASDY
DDFQAKGWTTEELLPLMRKHETYQRHSVNPDIHGFEGPIKVSFGNYTYPVKDDFLRAAES
QGIPFVDDLQDLSTGHGAEHWLKWINRDTGRRSDSAHAYIHATRAKHSNLYLACNTKVDK
IIMENGRAVGVQTVPTKPLHPNQLQTRIFRARKQIVVSGGTLSSPLILQRSGIGDPQKLR
AAGVEPKVDLPGVGLNFQDHYLTFSVYRAKPDTESFDDFVRGDPEVQKRVFDEWHLKGTG
PLATNGIDAGVKIRPTEQELKDFERWPTPHFTEGWKSYFKDKPDKPVMHYSVIAGFFGDH
MLMPPGKFFSMFHFLEYPFSRGFTHIKSADPYDTPDFDAGFMNDERDMVPMVWGYIKSRE
TARRMDAYAGEVENMHPFFDYDSPARAHDLDLDTTKQYALPGNLTAGIGHGSWSSPLPEA
DRKPGANILNSNKAHIREELKYSEADIKAVEEWVKRHTESTWHCLGTCSMAPKEGNSIVK
HGVLDERLNVHGVKGLKVADLSICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGEALEM
KVPTYQAPGELEVRHRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	652	4.4e-254	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.58e-79	16	676	4	555	choline dehydrogenase; Validated
225186	BetA	4.12e-73	16	650	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	4.40e-44	90	321	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.63e-26	438	643	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.43e-11	5	300	43	307	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61599.1|AA3_3	0.0	1	677	1	677
QGI92498.1|AA3_3	0.0	1	677	1	677
CCT65447.1|AA3_3	0.0	1	677	1	677
QGI78786.1|AA3_3	0.0	1	677	1	677
QKD51846.1|AA3_3	0.0	1	677	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	14	666	3	651	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	2.41e-241	15	668	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	3.92e-240	15	668	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	2.60e-50	17	650	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
5NCC_A	1.07e-49	9	647	15	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04841|ALOX_PICAN	0.0	14	666	3	652	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	0.0	14	666	3	651	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2QY27|ALOX1_KOMPC	0.0	14	666	3	651	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|F2R038|ALOX2_KOMPC	0.0	14	666	3	651	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04842|ALOX1_KOMPG	0.0	14	666	3	651	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FPRO_04143-t41_1-p1.