CAZyme Information: FPRO_03972-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_03972-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595		65905.70	5.8636

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000014:570304-572189(+)

Full Sequence      

MAFVANGNEYDFIIVGGGTAGNTVAGRLAENPHVRILIVEAGIPNPHQIPEITTPSKAFN
LRGSKHDWAYKSTMIKRDDYERIEKPNTRGKVLGGSSCANYFTWIPGSKPTFDDWEAFGG
EDWNWDGCVEYLRKCATYHDEEGLYPAELGKIGTGGPIQIAHADLVPEMQPWRDALTEAW
VSKGEVLTENIYDGEMRGLTHCVDTIHGGQRQGSFLYLKNKPNVNILYGVQSKELIIDPR
TNTCLGVTVINPDTKGELSVFASKEVILSQGVFETPKLLMLSGVGPAQELQKNGINVKLE
SPHVGQHLLDHPIVPFVLQVKDGFGLEDYILRDGAANSAAVAQYKRDKTGPVSSGLLELV
GFPRIDERLEQHQSYREAKAANGGLDPFGPKGQPHFELDFVGMFSTAFQWHYPVPEKGNY
MTVIVDLLRPLSEGQVTLNSNNSLVQPNINLNFFGNDLDILAMREGVRWTYDVLTTGKGF
KDIVTGEYPWRMPLESDEEMKRAVLDRSQTGFHPCGTARLSKNIQQGVVDSRLRVHGIKN
LRIADASVIPVIPDCRIQNSVYMIGEKGADMIKADHPEIFGQEASTRANPFTSRL

Enzyme Prediction     

No EC number prediction in FPRO_03972-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	7.6e-147	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.97e-83	7	579	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.23e-82	8	577	4	536	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.37e-41	430	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.39e-22	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.64e-20	8	565	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT65282.1|AA3_2	0.0	1	595	1	594
QKD51991.1|AA3_2	0.0	1	595	1	595
QGI61436.1|AA3_2	0.0	1	580	1	580
QGI78622.1|AA3_2	0.0	1	580	1	580
QGI92334.1|AA3_2	0.0	1	580	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	6.58e-301	6	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.88e-300	6	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	5.38e-300	6	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.19e-72	9	575	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.19e-71	9	575	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	2.63e-59	9	572	40	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q8UH55|BETA_AGRFC	4.94e-57	9	577	2	530	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|Q1MJU4|BETA_RHIL3	2.53e-56	9	577	2	530	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=betA PE=3 SV=1
sp|V5NC32|PDH1_AGAXA	6.48e-56	9	576	40	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q88AE7|BETA_PSESM	2.56e-55	8	577	5	540	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999613	0.000448

TMHMM  Annotations     

There is no transmembrane helices in FPRO_03972-t41_1-p1.