CAZyme Information: FPRO_03779-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_03779-t41_1-p1
• CAZy Family: AA8|AA3
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48772.34	9.4389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000002:227532-228845(-)

Full Sequence      

MHISSLFSTALLFSTAVAAPQPDYSTTSAANHGKVAKYQKQCPFSIPHVKPHSQRYEHTI
NFPKGCESGKFINWKTYKANGVNLGAWLAKEKTHDPIWWNSLGTKAAASIDEWGLCQALG
KQCGPILEKRYESFLNTSTIDTLAKVGVNTLRITTTYAAWVKVPGSAFYHGKQQEHLRKI
TQYAIERYNMHIIIGLHSLPGGINNLDIGEAFGHDGWFYNSTNLAWSYKAVDKVLDFVKA
SGHKNAFTIAPLNEASDNLAGFGSAAGLSDKATNWILTYMNGVFQRVEAVDKRIPVMLQD
NFKGAAFWSPLFDKKRNLVIDSHVYYFAASGTYSQYVAPAVCGQAKYLAEETKFPVFVGE
WSLQTMYNNTLSVPNRKTIFDTQRYAWQKYVAGGAFWTAVSYSNTPVDGQGIQRDYWSYV
DLIRAGVITKATTKSYC

Enzyme Prediction     

No EC number prediction in FPRO_03779-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	131	410	2.2e-118	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	0.010	68	213	7	153	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53692.1|GH5_23	0.0	1	437	1	437
CCT64988.1|GH5_23	0.0	1	437	1	437
QGI92196.1|GH5_23	0.0	1	437	1	437
QGI78478.1|GH5_23	0.0	1	437	1	437
QGI61298.1|GH5_23	0.0	1	437	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	9.46e-114	67	428	7	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	9.76e-113	68	426	11	367	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	7.73e-06	78	367	2	302	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	2.94e-19	72	362	35	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000318	0.999660	CS pos: 18-19. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in FPRO_03779-t41_1-p1.