CAZyme Information: FPRO_03772-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_03772-t41_1-p1
• CAZy Family: AA8
• CAZyme Description: related to esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1266		140430.30	4.9703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000002:244782-248792(+)

Full Sequence      

METGRNYPPEYAIPANPSAPFSFRKLLRDQLRYYGYNVDMLGTKNGGTMKDNDVEATSGY
VVSQIHAASKLSYKYKPNLVFINAGTNDLVHNIDTGNQHERLKSMLLDLWSNISDKTVII
LSTILPVDKPEAESLRGPVNTKYRAVVSELRKQGKPIFLADLDGFMTLDDLGDGTHPTDY
GFSKMAGAFWSAFQQAEDEINDPLPADLAGDSGKTCRKSPGDGVNAGSQTQRGSGYDDGT
YEHDSQEMGTLMTITSDWDRGQWFFARLFRSDRDDLLGWVENSAGNVVYAIRRNDGAGKF
TKISTDLDVHDNCKIKGVVFIDLNGDGLDDFACIGSDGAVYASINQGNGGGDKPPTFVYK
GLWRAADSRYPQNKVRLADIDGDGRADFCGLADNGDVYVWRNGWIDDMPKYWQALGKRFE
GKGMGNLDGTRFEDINGDGRDDWAWVGDQGETFLWTNHRSCGVGKEGDGLKVAWRPGYYK
GKTSGPTHTGGFAKGIRNRIHFARIYGEPQDFGLLGKQDYVYMEHSKGSDGKHTFKMRVW
KNKGYGGTKLKGDGNKYCDMTGNGRDDYVWVLSKGEMNFYPNAGKDFITDKDSYWGPMQK
AFFKPPRDLDRRDIYLTDWDGDGKCDIVWVDPDNKNHVSVWKNNYTPGGGFSWQYLSNPA
PELYCPEKRGIGFGDLAVQFADVTGNGLSDYLCLEKNGRIWGWTQDSQGSWTYIDQFFGT
KGHDRANMRFADVDGDGRDDAIWVEKFSGDSFVYYNKGRKDIAGSRYHWEIQERGGPFPA
YGGSYAGSCQYFPDLNGDGRADLHSIQATFPNTAVTAYNICDGNRSGDDSSEIKKPDLIT
PNNPGGGGSEESNSPPIPAENCKVVPDFMYTPLKRVGRSASGEDYCFAKWNKGVFIKEIE
AVASSGSLRYIRVAYTDGTIEEAGVKVPDDSHHRFGTVKWDPWSDYFNVFEMHDGGFKGG
IGRIVLEMSNKCGGDGNCKLDAGNYMDFPPVMQRIPRGDSDQGMLLGIRLNAGDVIENMI
PMFSKARPLKVTLGEPNFTPTFEELNSKPFEERQMEIVRTSHVVYNRRADKPVEMGIDLY
LQVEKGTKVNWNTQMGWESGGEIGGTIGGGMEWDIGLPEMIWAKVNGKLDVSGKWVGKKV
DMNFNGGEDSEIVRTMSRVTINTVVDPGKAALCQVVAIQSKANIRYHAMLTQHFANGDAY
SYPVQGVFRDSRVTEAISECMDVNEDNKDEAAAAVVIEQSGTYCNDGTRVGDTGMSDEEL
REACNL

Enzyme Prediction     

No EC number prediction in FPRO_03772-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	21	192	1.9e-40	0.9020618556701031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.11e-30	51	193	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	2.82e-10	29	192	17	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.91e-09	32	181	18	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
404411	VCBS	2.07e-06	322	388	1	59	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
404411	VCBS	2.18e-06	682	743	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91538.1|CE0	0.0	23	1264	84	1332
EAA58486.1|CE0	3.17e-282	23	838	82	916
EAA66327.1|CE0	2.33e-245	23	841	80	866
ABA65775.1|CE0	9.57e-243	23	838	80	912
AAD34550.1|CE0	9.57e-243	23	838	80	912

PDB Hits     

FPRO_03772-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_03772-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRO_03772-t41_1-p1.