CAZyme Information: FPRO_03355-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_03355-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: probable GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		46575.65	8.5411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000002:1282662-1283991(+)

Full Sequence      

MGLLNHETNPISSLTAAFSAWKGLLLAIALGASVGPDYDTSTSLFFNIVHGPTTPVPALA
TRLTRWDALYFMHDAVKGKVYEQEWAFGIGLPAVVRGINVLFGLEEGWDAIIAIAISHVS
HLITVLALYQLTIVLCNDRKLAYLAAAVHILSPGGLFLSAPYAESTFACLSFVGNLLFAL
GLKSSPDSMRRNISVIGAGLLYGVSCVFRSNGLFGGVLFAVEAIKGLTALLGGFSFSKVL
RLVAPIIGGLFVAVGFVAPQILAWMRYCNVQDNGQQRPWCTRPLPSIYTFVQEEYWNVGF
LRYWTPNQIPLFLLAAPMLTILIKSGTEVVREPSRGLRAMISGTDEECRLLVRTLAAVQT
LLAVLAITNYHVQIISRISSAYPVWYWWVASCLVDKQRQNLGYGVVVFISMYAMIQGGLF
ASFLPPA

Enzyme Prediction     

No EC number prediction in FPRO_03355-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	19	427	3.4e-111	0.9852579852579852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.61e-36	38	427	27	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.62e-21	65	427	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64606.1|GT76	3.02e-310	1	427	1	427
QGI91835.1|GT76	1.86e-249	1	351	1	351
QGI60934.1|GT76	1.86e-249	1	351	1	351
QGI78121.1|GT76	1.12e-243	1	351	1	351
CEF85209.1|GT76	1.97e-243	1	427	1	423

PDB Hits     

FPRO_03355-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	3.49e-244	1	427	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	7.41e-118	7	427	15	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	8.97e-88	3	427	22	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.12e-83	4	427	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.01e-57	12	427	5	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997472	0.002546

TMHMM  Annotations     

Start	End
13	35
107	129
141	163
213	235
242	264
308	330
350	367
372	394
401	423