CAZyme Information: FPRO_03301-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_03301-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: related to glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186	FJOF01000002|CGC7	20540.46	4.1897

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000002:1424316-1424983(+)

Full Sequence      

MDEEHVSVTDGVLTLTAEPRDDQEDPIHYLSGAIHAKSTFTVSAGGGYDISAEFIAPVDR
GTWPAFWLNAASGWPPEIDIAEWKGSGKISFNTFNTSNEVTALDRDYPDPEEWHSVRAEL
RDENGRDVRVKFFLDGVEQTTQYGRDYIGAGLRLIVNYQTEGSSGSPGPTTPTTFQVRNI
EVISLN

Enzyme Prediction     

No EC number prediction in FPRO_03301-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	1	168	3.2e-65	0.8979591836734694

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185693	GH16_laminarinase_like	2.38e-12	2	177	36	229	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	2.32e-08	2	182	28	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.16e-04	1	94	1	82	Glycosyl hydrolases family 16.
225182	BglS	1.84e-04	1	148	77	224	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185690	GH16_fungal_Lam16A_glucanase	4.83e-04	34	82	72	117	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI60884.1|GH16_10	3.98e-135	1	186	1	186
CCT64557.1|GH16_10	3.98e-135	1	186	1	186
QGI78071.1|GH16_10	3.98e-135	1	186	1	186
QGI91785.1|GH16_10	3.98e-135	1	186	1	186
QKD53271.1|GH16_10	5.38e-133	1	186	60	245

PDB Hits     

FPRO_03301-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F7J1C8|E3GAL_FLAVE	1.59e-54	5	182	57	244	Galactan endo-beta-1,3-galactanase OS=Flammulina velutipes OX=38945 GN=EN3GAL PE=1 SV=1
sp|Q9Z3Q2|EGLC_RHIME	8.96e-11	7	100	277	372	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000049

TMHMM  Annotations     

There is no transmembrane helices in FPRO_03301-t41_1-p1.