CAZyme Information: FPRO_03228-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_03228-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: related to mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		44471.59	5.6846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000002:1648463-1649688(-)

Full Sequence      

MLNSRRAIVAAVFILTVFFLLTRSHTTTPVVPAAKDAAATAVDTSKNDAPASNQAVSPPP
EEQKEMEVKERRTRPRIDMSGMSIFEKLEYAYPYDVATKFPAYIWQTWKQSPDQGDFQFK
DHHASWKEEHPGFVHEVITDDVAVNLIRLLYATVPEVVEAYRSLPMPVLKADFFRYLILF
ARGGIYSDIDTYAIQSSVKWLPEQIPRDTIGLVIGIEADPDRPDWAQWYSRRIQFCQWTI
QAKPGHPVLRDIITRITKKTLELKNQGKLEKFIDRNVVEFTGPAVWTDAIMEYFNDPRFF
DMSQSKGTIDYKNFTGMETSKRVGDVVVLPITSFSPGVGQMGAKEPDDPMAFVKHDFEGT
WKPESERHMGEQQQEGQPAVQAPQAPQAPLQ

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	120	203	1.1e-19	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.15e-47	60	362	42	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.21e-16	125	204	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI91722.1|GT32	5.08e-261	1	391	1	391
QGI60821.1|GT32	5.08e-261	1	391	1	391
CCT64497.1|GT32	5.08e-261	1	391	1	391
QGI78008.1|GT32	5.08e-261	1	391	1	391
AGF29563.1|GT32|2.4.1.257	7.31e-252	1	374	1	374

PDB Hits     

FPRO_03228-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	5.23e-95	86	362	85	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	7.48e-83	89	362	133	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.53e-72	86	362	116	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.78e-71	86	370	82	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.444828	0.555172	CS pos: 26-27. Pr: 0.4342

TMHMM  Annotations     

Start	End
7	26