CAZyme Information: FPRO_01900-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_01900-t41_1-p1
• CAZy Family: AA4
• CAZyme Description: related to xyloglucan endo-transglycosylase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	FJOF01000001|CGC21	35429.90	4.2600

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000001:646155-647111(+)

Full Sequence      

MSSTKSLLASILAIAPLALAQDPSCDCYVTKGDSPQYYTSHSFFDFRSLSQYAGVPPLID
SIQGNADADFSSDFFNWESEFTQTWGPQKWNNGNEEFPMQNTYNNLYIEENNDVSPASDT
WLTMRTARHNGFQTASEFESLEKHQYVSLRMYARTKGSPGACTAMFTYLNGGSLALVQEA
DIEVLTKDDPTIIHYTNQPSYTDEGGEVEGAHLAATLPDGLKWTDWAKHTIDWTPDATIW
KVNDKETWRNAFQVPRDPAQLSFNAWSNGDTWTGTIPEGGAAYQQIQWIEVLHGRTEQGS
CNRVCSVDEGEAGKAVPV

Enzyme Prediction     

No EC number prediction in FPRO_01900-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	83	291	2.1e-86	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	6.91e-52	75	291	3	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	3.67e-06	146	292	118	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
395585	Glyco_hydro_16	6.41e-05	133	273	20	156	Glycosyl hydrolases family 16.
185684	GH16_lichenase	2.18e-04	134	289	56	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185692	GH16_fungal_CRH1_transglycosylase	0.006	223	270	114	168	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46650.1|GH16_22	1.31e-242	1	318	1	318
QGI90513.1|GH16_22	2.65e-242	1	318	1	318
QGI76805.1|GH16_22	2.65e-242	1	318	1	318
QGI59602.1|GH16_22	2.65e-242	1	318	1	318
CCT63135.1|GH16_22	2.17e-241	1	318	1	318

PDB Hits     

FPRO_01900-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_01900-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999721	CS pos: 20-21. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in FPRO_01900-t41_1-p1.