CAZyme Information: FPRO_01687-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_01687-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	FJOF01000001|CGC3	90813.79	5.3469

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000001:1196080-1198709(+)

Full Sequence      

MASVDIQSILSSLTLEEKISLLAGKDLWETVPISSKGVPHVKVSDGPNGARGAAFAGGTS
AACFPAACLMASTFDVNLAKRIGTALAEETHSKGARCLLAPTMCLHRHPLGGRNFESFSE
DPFLTGKMAARVVEGLQDKGVSATIKHFAANEQETERLTVDETISERTLRELYLRPFEIT
IKEANPWAVMTSYNQVNGHHADSNEFLLKKVLRGDWGWDGLVMSDWGGVNSTAESLEAGL
DLEMPGPTRWRKTEDVIAAIKAGKTSEETINERAKRVLKFLERLNCFKDPSIPEERAINN
PKHQALIREAGSKGIVLLKNQDNVLPLSKDKVKGKKIALLGHAKIGLAHGGGSASVNAHY
KVTPWDALHEALGDSAEFSYAKGAHTFRMLPPIAENVVDLDGNPGFTFKIFEPGNPEPIE
VRPAHPDSEVSVLSGFGFSNKDVTLEGTFTAQETAKYYFTASGLGPSKLIIDGKVVFEQK
ENSKDAMGFLFGGDNPPEFKVSLEAGRKYKLAMHTSPPAAKDGEDLDLGILEGRCGLRVG
YMSEAEHDRDLLSEAVDVAKDADYAIIFTGHEPFWETEGQDQVSFNLPKDGSQDRLIAKV
AEVNPNTIVVNSTGVAIAMPWLEKIQGLVQTWFPGQEAGNSIADVLTGAQTPEGHLTCTF
PKKLEDCPAYGNFPGKHVDGRLRVTYGEGVFIGYRYFDCLSADKVNFPFGFGLSYTTFDY
SDLEVKESSDDYTVSVKVSNAGKVVGAIAVQVYVGAAETAKGDPLKQLAAFEKVTLKPGE
STKVEIPVRTRDFAFFDESAKKWVVKGGDYKFMIGRSAGDIALESKIAVEEKSFDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	1.7e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.21e-78	64	835	120	763	beta-glucosidase BglX.
224389	BglX	1.96e-67	61	346	80	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.52e-49	315	694	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.99e-46	7	815	54	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.08e-45	64	278	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT62926.1|GH3	0.0	1	836	1	836
QGI59406.1|GH3	0.0	1	836	1	836
QGI90315.1|GH3	0.0	1	836	1	836
QGI76614.1|GH3	0.0	1	836	1	836
QKD46840.1|GH3	0.0	1	836	1	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.77e-180	1	834	1	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.44e-175	5	834	5	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.19e-137	3	829	2	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.71e-118	6	836	4	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.55e-117	6	836	4	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	6	836	11	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	9.42e-195	1	834	1	834	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.73e-194	1	834	1	835	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	3.86e-194	1	834	1	835	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.46e-194	1	834	1	834	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999928	0.000097

TMHMM  Annotations     

There is no transmembrane helices in FPRO_01687-t41_1-p1.