CAZyme Information: FPRO_01390-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_01390-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: related to UDP-glucuronosyltransferase 2C1 microsomal

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	FJOF01000001|CGC34	61800.75	6.9176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000001:2122578-2124286(+)

Full Sequence      

MADSHEFRRRILLLATTGGFTHAAPVLEIGAVLASRGHEVQFATCAGQEDWTANYPFIKT
VYTVGPAASEDDLDVHYETMRLWRHEHGFGPMMRSKYFFDNFWTDTYKSLRSLCENDSTR
PDFIVADFFADSAARDMFKQFNIQLASVWPQMPYAMAPVSYHPGQPGFQADGVLTSEHAS
LSSRFWNEFVVLAALPAIIPWLIWTKRMRVDAGVNYSHSLLSKPDYLVLVNSFWGLEAPK
ELPPLMAPVGPILSDEYLPLDDDLAQFLSNHDRTIYVCLGTHVNLPGEELEKYLLGFIQA
LDEDSINGVIWSIPQKPRANFDTLKSYNLSDGSSISITGLLNDSHPRFRLPIFAPQRAIL
AHRHTVLFLTHGGGSSANETLFHGTPVLAIGYFFDQLCNSARLKAAGVGMSLDKSYLTPS
SISSAIANIIKDEDGSFAMNVRRMQGIAVLNSKRKHAAADLIEEVMIDQELRFKKGVELR
PMHLQTADMRMPIWKARNWDMWSISLTGLAVSGMVSWWFATHGWKKLPVILARSVRLSRG
FARGILDSPRS

Enzyme Prediction     

No EC number prediction in FPRO_01390-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	124	446	2.4e-27	0.6963350785340314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.32e-44	10	464	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	9.60e-19	8	466	1	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	3.93e-12	229	481	230	451	UDP-glucoronosyl and UDP-glucosyl transferase.
178572	PLN02992	3.46e-10	228	436	204	431	coniferyl-alcohol glucosyltransferase
215127	PLN02210	8.59e-09	187	412	158	391	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI59140.1|GT1	0.0	1	551	1	551
QGI90050.1|GT1	0.0	1	551	1	551
CCT62669.1|GT1	0.0	1	551	1	551
QGI76352.1|GT1	0.0	1	537	1	535
QKD47039.1|GT1	0.0	1	551	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	8.34e-13	280	432	19	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	4.28e-12	298	432	33	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	2.50e-10	349	447	71	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2VCE_A	1.29e-09	228	440	210	437	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
6PNT_A	1.04e-07	367	471	336	437	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36514|UD2C1_RABIT	1.65e-14	229	447	230	421	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|Q6K1J1|UDB31_CANLF	4.18e-14	218	447	248	449	UDP-glucuronosyltransferase 2B31 OS=Canis lupus familiaris OX=9615 GN=UGT2B31 PE=1 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	3.92e-13	227	433	246	431	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|P54855|UDB15_HUMAN	5.28e-13	229	432	258	436	UDP-glucuronosyltransferase 2B15 OS=Homo sapiens OX=9606 GN=UGT2B15 PE=1 SV=3
sp|O75795|UDB17_HUMAN	5.28e-13	229	432	258	436	UDP-glucuronosyltransferase 2B17 OS=Homo sapiens OX=9606 GN=UGT2B17 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.798145	0.201859

TMHMM  Annotations     

There is no transmembrane helices in FPRO_01390-t41_1-p1.