CAZyme Information: FPRO_01253-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_01253-t41_1-p1
• CAZy Family: PL1
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	FJOF01000001|CGC9	51521.25	9.1430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000001:2556591-2558000(-)

Full Sequence      

MVVISRRTRRRLRSILILILISTFIIYSILPHDSAIRLAFVFNISRFFNFLRGAATNRDA
WLWKSPRYAVDLKNEVGYLIKTGYGTRHRVPDQLAAFEATGGFLGKEGESFLVVGDWKTV
NQTDAKLIGVTVHDAIKRVMETKIRGKVDDYPRLVKYTSLQAKLQAGDEEEALKIGQSYG
WELDALKFIMGMEMIYHQLPGKKWYIILDDDTFLIRPSLELLMGHVDYRKPQYIGNAVGD
YKARFGHGGSGILISGEAMRRLFEHPGIVQEAYAESMTETWGDRLVATTLQKLGIYIEES
YNHHFNGEPPSITRIWGDRFCSPLLSFHGLRKPGEMRRVGETLAKIDKPVLWHDVWQLFG
GSAMSALESRPTELTADHVGKPDEHTRSWGDVRSANACQKRCEQSGRRCLAWTYEMEIER
CHTSPWLLLGADGATGKASGVNWPEVKPLLKGCR

Enzyme Prediction     

No EC number prediction in FPRO_01253-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.002	185	262	68	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
133028	GT_2_like_b	0.008	188	261	68	135	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT62550.1|GT31	0.0	1	454	1	454
QGI76233.1|GT31	0.0	1	454	1	454
QGI59018.1|GT31	0.0	1	454	1	454
QKD47275.1|GT31	0.0	1	454	1	454
CEI64026.1|GT31	0.0	1	454	1	454

PDB Hits     

FPRO_01253-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRO_01253-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000001

TMHMM  Annotations     

Start	End
12	31