CAZyme Information: FPRO_00585-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_00585-t41_1-p1
• CAZy Family: AA12
• CAZyme Description: related to endo alpha-1,4 polygalactosaminidase precusor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		37160.83	4.6193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000001:4622579-4623645(-)

Full Sequence      

MVTFNQIALTVLAVGGSVSARRKDECRVANHVKAVEAKPAAAASSAFFELSDFKPGVEWE
IVLHQPIKHDTVADLIPSKAKVWDIDMGHGRDYPEMIPLLKGAGKFVICYFNAGALQSWD
KDIKQFPDAVIGHSLAYPYDSEEWYLDIRDSTVLKLQKARLDVAAKIGCDAVDPDNVDAW
QQDGEDPTGFKLKPSDYTKYLKNLAEYAHSIKTKDGNRLLVGQKNAPEVAEDLVSTLDFA
VLESCRGTTDPDEENWPFCEDFQTYIDAGKPVLQIEYPPSVEKTGKLSSSDNAYYCTPKG
EDKGFSKILKWASAQLDGWGQFCGEDPFHTPVINE

Enzyme Prediction     

No EC number prediction in FPRO_00585-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	59	277	8.2e-50	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	6.25e-68	59	310	2	215	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	5.13e-11	63	281	61	270	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	1.56e-05	94	277	63	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI89288.1|GH114	7.41e-253	1	335	1	335
QGI58377.1|GH114	7.41e-253	1	335	1	335
CCT61950.1|GH114	7.41e-253	1	335	1	335
QGI75595.1|GH114	7.41e-253	1	335	1	335
QKD47958.1|GH114	2.68e-233	1	335	1	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	3.73e-31	56	323	39	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	5.37e-31	56	323	56	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FPRO_00585-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.575794	0.424215

TMHMM  Annotations     

There is no transmembrane helices in FPRO_00585-t41_1-p1.