CAZyme Information: FPRO_00340-t41_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRO_00340-t41_1-p1
• CAZy Family: AA11
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	FJOF01000001|CGC31	34447.37	6.6972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumET1	16509	1227346	366	16143

• Gene Location: location=FJOF01000001:5373998-5375180(+)

Full Sequence      

MFSKSVLIALVPFAVAGPIAPRQGLGSGLGSGLGSGIPSFGLPSSGGDSTGGLPSIPSIP
SLGSGGSTGGLPSIPGLGSGGSSGGIPSIPGLPSSGGSTGGLPSLPIGGGGSSFLPGGST
GGDTTGDTSGDTSGSASTSAPASQPTGSSEIPRAEGGSSTSPFGSFLGSAGGSSGGFGGS
TQNGLSGDCKDVTVIFARGTTEMGNVGTAAGPPFFQALAQQLGSDKLAVQGVEYAASVGG
IMQMGDQAGSQKMASLVKEAYQKCPKTKVVMSGYSQGAMLVHNAAKSLPADTTSKIAAVV
NFGDPFQRQAIQGVPSDRVKIICHAGDGVCAGTAAITPDHLTYSQDANTAAQFVVSKVK

Enzyme Prediction     

No EC number prediction in FPRO_00340-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	189	358	6.2e-48	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.37e-56	189	358	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI75372.1|CE5	3.98e-176	1	359	1	364
QGI89066.1|CE5	3.98e-176	1	359	1	364
QGI58153.1|CE5	3.98e-176	1	359	1	364
CCT61737.1|CE5	1.86e-175	1	359	1	368
QKD48196.1|CE5	7.47e-146	1	359	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	2.19e-46	189	358	79	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	6.95e-28	187	358	19	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
1AGY_A	1.04e-27	183	359	11	194	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]
1FFC_A	1.48e-27	183	359	25	208	Chain A, CUTINASE [Fusarium vanettenii]
1FFA_A	1.48e-27	183	359	25	208	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	2.04e-58	189	354	31	196	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	5.33e-52	189	354	31	195	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q9Y7G8|CUTI_PYRBR	4.45e-51	188	359	31	202	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	1.23e-46	181	358	58	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|A0A024SC78|CUTI1_HYPJR	9.51e-46	189	358	79	247	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999708	CS pos: 22-23. Pr: 0.9116

TMHMM  Annotations     

There is no transmembrane helices in FPRO_00340-t41_1-p1.