CAZyme Information: FPRN_15169-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_15169-t42_1-p1
• CAZy Family: GT8
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		68050.21	6.9101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000047:63726-65768(-)

Full Sequence      

MSPLSTWVLATVSTALVSTVDGYNIPRSAHQACRISNGSEILPAYDYVIVGGGTSGLTVA
DRLTEDANTTVLVLEAGIFAADADVLPVYNGGTQRQPRFYWQSKPQENLDNRTVPVWLGK
MVGGSSGVNAMMASRGSSMDYDRWGKLFPEANGWDWEGMLPYFRKGLHMNPPAPQMAARF
NISTNPKYWGKDSAIQASFPNYEYPGLEHMSKAFYELPGIEPVEDSGAGGAGVYWFPTLM
DHFRYERSFAENSHYRGLSRPNYHVAPSSRVRRVILNKGVATGVEFYGADGLLTVKAKKE
VLMAAGAIHTPQLLQLSGIGPKKLLHAAGIKTQVDLPGVGQNFQDHINIGVSITLEGLKK
IHPNPSDLANGTDFKKWADEAWAVNRTGPYSIAWGNLAGWLPLSAISPERHLQLADQLEK
QDHASYLTDDVHPTVAKGYALQMKNMAAAMRSKDVVFARYLVDANTGASAPILNQPMSRG
SVTVDLKDPYNSNPVVDFGSLRNPVERSVLVDMVKWYRRYNFETSLSKLSPNETAPGVDV
VSDEDISAWIPKALFPTDYHPAGTAAMMPLDHGGVVDQKLRVYGVKNLRVIDASIMPSLP
GSNTCQPMYAVAEKAADIIKSDA

Enzyme Prediction     

No EC number prediction in FPRN_15169-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	44	622	5e-162	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.54e-87	45	620	6	532	choline dehydrogenase; Validated
225186	BetA	1.66e-84	39	623	2	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.18e-31	476	615	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.41e-24	110	346	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.41e-15	28	603	41	560	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT76262.1|AA3_2	0.0	1	623	1	613
QGI88770.1|AA3_2	0.0	1	623	1	635
CEI67552.1|AA3_2	0.0	1	623	1	620
QBZ63758.1|AA3_2	3.50e-281	7	621	11	624
VBB80399.1|AA3_2	9.84e-188	37	623	31	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	8.69e-110	45	622	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	5.79e-93	9	619	4	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	1.96e-66	45	623	6	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.16e-57	45	622	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.01e-57	45	622	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.03e-107	45	622	38	616	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	3.68e-81	44	619	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	3.68e-81	44	619	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.81e-74	1	622	1	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	4.38e-69	14	620	4	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000608	0.999389	CS pos: 22-23. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in FPRN_15169-t42_1-p1.