CAZyme Information: FPRN_14447-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_14447-t42_1-p1
• CAZy Family: GT32
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	FCQG01000027|CGC7	59916.68	5.4883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000027:628741-630505(+)

Full Sequence      

MASPIYDYIVVGGGLAGCVLSSRIREYDDAVKILLIEAGKETRGRSDVHNMQVLNLGGEL
DWQYQSEPVEALMGRQITLNAGKGLGGSSAINSGGWTRGAAADYDAWAALVGDERYSYKG
QLPWFRKSELWFDDKNPEQHGRDGPIRVTCAKASNRVFPLAEKAAAGWEELGVSTLPDGD
QNSGNNLGRAYICEARSDGKREWSANQYSLDGVQVRLETFVNRIVIQKIDGNLKATGVEL
ADGNVVNGHNIIISAGAFRSPQLLQLSGIGPKTHLQEFGIEPLIDLPEVGKNLSDHMIFF
QHWRLRDTSAGHTIGSSNPLFQQHQYSQGVPFDWIVNTGIPREGLAKAIERDEGTKPRES
EHVLLTKDRTFVENIIMFAKLPFPGVPMDAEHITSALVSFLPTSTGSVSLKSGKPGEHPK
VDLNYLSTEVDKHVFREGLRQLTRFMLESKFSDQIIGESIPEGLPVEALALDDNDAKLDQ
RIAMTGGTSWHPSGTCSMGKVVDTEFCVRGVEGLRVVDASVFPVPLSAHLQAPLYALTEQ
AAAIITGKV

Enzyme Prediction     

No EC number prediction in FPRN_14447-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	546	1.9e-134	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.66e-91	1	548	1	534	choline dehydrogenase; Validated
225186	BetA	2.27e-83	1	545	3	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.44e-35	402	541	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.80e-31	6	522	56	553	Protein HOTHEAD
366272	GMC_oxred_N	3.03e-26	6	298	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI70777.1|AA3_2	0.0	1	549	1	549
CCT75503.1|AA3_2	0.0	1	549	1	549
QGJ01668.1|AA3_2	0.0	1	549	1	549
QGI88121.1|AA3_2	0.0	1	549	1	549
QKD62572.1|AA3_2	0.0	1	549	1	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	6.55e-61	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	6.55e-61	2	548	1	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	6.55e-61	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	6.55e-61	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	8.89e-61	1	548	19	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.18e-89	3	548	2	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	6.64e-66	6	548	5	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	2.26e-64	1	548	1	535	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|P0DO29|ERIK_HERER	6.85e-64	1	548	29	598	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	1.35e-63	3	548	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999909	0.000116

TMHMM  Annotations     

There is no transmembrane helices in FPRN_14447-t42_1-p1.