CAZyme Information: FPRN_14116-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_14116-t42_1-p1
• CAZy Family: GT20
• CAZyme Description: related to UDP-glucuronosyltransferase 2C1 microsomal

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	FCQG01000022|CGC1	62087.18	9.4403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000022:760845-762557(-)

Full Sequence      

MPSSELAHPSRKILLVVTTGGFTHASPVFEIGKILAARGHTIEFATLEGQEAWTKGYEFI
TKVHTLGPGPTHDQMNAHYLRMRTWDISKGISGTMPSKYLWDSFWPQTYRGLKAIMDDPK
TRPSMMIADFFVDAVKDIHVEYNLPITQVWPQMPFLMMPCSYIPGQPGFQLEGTLTSEHA
SLWHRIKNELVIFFDLPVILKWMKWTKKMRLENGVKYPPHKIQKPDYLIFVNSFLGLEIP
RDLPPTCAPVGPLISDTYPPLNEECEQFLTKHTKVIYIALGTHIILTNADAAKIINGLLL
LLEGSLLDGVIWSIPKSGRQDLDVNTTYKTGNKTLRLGDILDGKNPDWLCSTFVPQRAIL
DHPSTKLYYTHGGGSSANEGLFHRVPMLSMGVFMDQISNTARLVDGGVAEPLNKFRFTSQ
EIYTKAKKILLDEDGSYKRNSLRLMRIAHVAARRKQHAADLVEELIYDTELRFKDGKELR
PMHLQTADMRMPVWKAKNWDIWAVSLLGIGAVFGGLGIGGRLLWLHRGWLTGSVKGFVGS
QEWLRNLIK

Enzyme Prediction     

No EC number prediction in FPRN_14116-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	211	464	9.7e-19	0.5157068062827225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.86e-39	15	465	4	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.46e-18	10	466	1	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	2.70e-16	337	481	301	451	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	2.27e-13	20	465	4	389	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	7.37e-12	355	479	355	473	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59607.1|GT1	2.26e-299	3	549	2	553
BCR88254.1|GT1	1.68e-258	8	527	6	530
QLI65751.1|GT1	6.21e-255	6	540	1	537
QQK45460.1|GT1	2.68e-253	3	548	2	552
CAK97035.1|GT1	4.56e-252	3	543	2	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	1.33e-13	251	449	19	191	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
2O6L_A	1.36e-12	255	449	1	169	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7CJX_A	1.98e-11	342	443	60	164	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6JTD_A	3.69e-08	245	443	243	449	Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis],6JTD_B Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis]
6PNT_A	7.35e-07	353	433	324	402	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36512|UDB13_RABIT	2.02e-18	156	449	189	452	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q9GLD9|UDB33_MACMU	6.29e-18	115	481	148	478	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|Q9TSL6|UDB23_MACFA	1.97e-17	115	481	148	478	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|P36514|UD2C1_RABIT	4.19e-17	156	449	160	423	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|Q6NUS8|UD3A1_HUMAN	6.02e-17	3	535	15	519	UDP-glucuronosyltransferase 3A1 OS=Homo sapiens OX=9606 GN=UGT3A1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000016

TMHMM  Annotations     

Start	End
501	523