CAZyme Information: FPRN_14056-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_14056-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: related to glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	FCQG01000039|CGC1	44460.81	4.3316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000039:130714-131989(-)

Full Sequence      

MFTVCNKLWPFMRTLVIMLIGAEFGLCYLTEMADTMIAKGITPDLGYQDAVLYLGFEKVY
ELSGDKKYLDWYIGQIDGPVVQEDGSIKGLNTSRYILDEYRMGHNYLYLFNQTGETKYET
AANKVRRMLDTYPRTPSGGFWHQQFFRNQMWLDGIYMADSFYARWTHLYDSDNNTAWDDI
LLQYELIHEHTINETTGLHVHGWVEGQASWADPETGRAPNVWGRALGWYFMALVEVLQYF
PTSHAGYDQLLGYLGSVAKGLKDSRDPDLGSWWQVMNEPYPEREGNFIESSGSSMFTWGL
LKAVDLGYLDSDEYLETAKDAFTSLIHNFVTEGDDGSLVLNSTVAECGLTSSNVTFEYYV
SRPKLENGQNGVGPFMLASYEWESWAKDA

Enzyme Prediction     

No EC number prediction in FPRN_14056-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	383	7.9e-94	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	2.16e-67	35	383	17	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	7.17e-66	28	383	15	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75065.1|GH105	5.19e-294	1	389	1	389
QGI70454.1|GH105	5.37e-292	1	389	1	391
QGI87812.1|GH105	5.37e-292	1	389	1	391
QGJ01344.1|GH105	5.37e-292	1	389	1	391
QKD60262.1|GH105	3.17e-276	6	389	3	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.39e-83	28	384	4	360	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.85e-56	20	389	8	371	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.68e-55	26	389	4	361	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.18e-10	47	381	56	370	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.44e-09	47	381	39	353	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.49e-55	20	389	8	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	3.07e-21	197	381	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	3.07e-21	197	381	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	1.13e-06	22	387	70	413	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.978901	0.021122

TMHMM  Annotations     

There is no transmembrane helices in FPRN_14056-t42_1-p1.