CAZyme Information: FPRN_14021-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_14021-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: related to sterol glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	FCQG01000039|CGC4	86250.38	7.8523

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000039:202564-205497(-)

Full Sequence      

MSKSGSQSPPKGKEVQDTDNVLDIPWDAPPPYELHSSGSVLASTSRVNDYGKVDIEFSSL
QPDEVNRLLPPDKAQEIEPSSSFSTAAPSGPCPALNVVIQVVGSRGDVQPFIALGVALQR
YGHRVRLATHDTFTDFVRSSGLEFYPVGGDPEDLMAYMVKNPGLIPSMESLRGGDIGRKR
VMIHDMLRGFWSSCVKPDPVSNRPFVADAIIANPPSFAHVHCAQALGIPLHMMFTMPWTA
TRSFPHPLANIQSQNMDPRASNYLSYGVVDLMTWQGLGDVINAWRVKDLHLDPLAAAVGP
DIVGLMKVPYTYCWSPALVQKPSDWGESIDICGFFMRDEPAYTPPQDLADFLARGPPPVY
IGFGSIVIDDPTALTNIIKESCRVAGARVIISRGWSKLGGNEPSTDSVFYLGDCPHEWLF
KRVAAVVHHGGAGTTACGLVNGRPTTIVPFFGDQPFWGSVVASNGAGPSPIAYKGISVDK
LSSAIKFCLSPEAQAAANRIATQMREESGVNTAVNSFHRHLPVANLICELIPHNAAKWQY
VGRSKKGDKGHIRLSNAALKVLLDAKKAKLADFEPLRPKEYLVENERWDPVTAGASSVLG
TMTDFTSALGGAFIDPFKDVKRVRPDGTRRSAGTATAVASGKALQGMTTAVVKGSLVDVP
LAFAEGFRNTPRLYGEKVADYGPVTDWKSGGTVAAKNFGFGFYEGLTDIVTKPMKGAKEE
GALGFFKGVGKGSLNMVAKPGSATFGLLAYPAQGIYKSIQSMKTNKARDAVTAGRVESLS
DGEQGATLPDAPQTIKRFQELIG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	115	519	1.5e-50	0.981675392670157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	9.32e-81	95	520	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.32e-40	103	519	10	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.01e-22	97	245	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	2.09e-05	106	509	7	378	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	0.004	692	759	2346	2413	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75037.1|GT1	0.0	1	803	1	803
QGI70427.1|GT1	0.0	1	803	1	808
QGI87785.1|GT1	0.0	1	803	1	808
QGJ01316.1|GT1	0.0	1	803	1	808
QKD60288.1|GT1	0.0	1	801	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.16e-73	102	527	27	445	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.94e-73	102	527	47	465	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.35e-33	95	513	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	3.51e-30	95	507	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.08e-24	95	501	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.99e-135	52	522	102	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	3.00e-134	93	524	191	613	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	1.04e-80	67	536	1137	1624	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q6C8M8|ATG26_YARLI	4.45e-80	102	529	1002	1421	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|A7ERM5|ATG26_SCLS1	1.04e-79	78	542	926	1387	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRN_14021-t42_1-p1.