CAZyme Information: FPRN_13281-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_13281-t42_1-p1
• CAZy Family: PL4
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		57263.90	5.5203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000026:224517-226164(+)

Full Sequence      

MTDCKRLLLFTNSDFGQANVVLATAHELGLARQEVEIHIASFQDLRSGVDDASRFMQATA
AQQKNKIPCPFVFHEIEGTSWGPATKRPETAIFETLELTPGLFNSAKGVAILPAVMIPWS
PKEFLDIYKETERVFDEVKPDLTIVEPLFTQGLTFCHHRGVRWMVLSPNTIKEFAVPVQP
KLAALWNACSALPYPIPWSLIPWNICFGFVAGYTLLTDTRLKRTTEILRKEVDTSIALMT
MMELGVLKPAPANLPILVASSPDIDYPFSVIPPQLTSCGPIIRAAPPIKEVDASLAAWLS
QGPTLYVNLGTHHKSNPSEAHEMSEAFRKVLEHADTMQPAGKPLQILWKLGRVLDEEGNA
PKRDSYTGEWALVTDELQAYIERDRVRITDWLVAEPKSVLESQSIVCSVSHGGANSFYEA
LCSGIPQALLPAWTDCYDFANRVELLGIGRWANKEAKPRWKEEELAGALLEILFGPESAG
MRKRAEEIASRHPEWKGRQIAAQEILDYLRRLE

Enzyme Prediction     

No EC number prediction in FPRN_13281-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.23e-24	84	508	49	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.18e-16	120	511	36	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	2.17e-10	290	488	254	428	UDP-glucosyl transferase
178170	PLN02555	4.91e-08	384	485	337	439	limonoid glucosyltransferase
177830	PLN02173	2.48e-06	381	487	314	420	UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74337.1|GT1	0.0	1	513	1	513
QGJ00663.1|GT1	0.0	1	513	1	513
QGI69774.1|GT1	0.0	1	513	1	513
QKD60995.1|GT1	0.0	1	512	1	512
CEI70655.1|GT1	3.34e-287	1	509	1	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6L8W_A	2.76e-06	399	496	336	427	Crystal structure of ugt transferase mutant2 [Siraitia grosvenorii]
6L8X_A	2.76e-06	399	496	336	427	Crystal structure of Siraitia grosvenorii ugt transferase mutant2 [Siraitia grosvenorii]
6L8Z_A	2.76e-06	399	496	336	427	Crystal structure of ugt transferase mutant in complex with UPG [Siraitia grosvenorii],6L90_A Crystal structure of ugt transferase enzyme [Siraitia grosvenorii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.83e-64	7	488	8	453	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	9.87e-62	7	455	8	435	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	6.54e-12	6	503	2	556	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	1.33e-09	335	503	394	557	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|Q9SKC1|U74C1_ARATH	1.71e-08	290	488	257	431	UDP-glycosyltransferase 74C1 OS=Arabidopsis thaliana OX=3702 GN=UGT74C1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRN_13281-t42_1-p1.