CAZyme Information: FPRN_13126-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_13126-t42_1-p1
• CAZy Family: GH76
• CAZyme Description: related to cell wall glycosyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	FCQG01000026|CGC1	47201.22	7.0170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000026:579157-580442(-)

Full Sequence      

MRFSLLALGSLASTAFAAGTNLPHGWFTFQPGQKLKHTEFQGRPRYLTWMADSQMQHGVE
PTLAYTVSAYYSGILRVYERTRDKKYFDYVKRGADILLYPEHDGTVLMYNNSNSIDDIRI
GHTFLDMYNSTGDEIYKKAATHMRKQIDRTGRTPDGGFYHRFPAYIDQMWLDGFYMLDVF
YARWTHEFEPNNSTAWDDIAMQFDLIDAGTRSSNHTNGLPVHGFDYSKSQVWADAETGAA
PHVWSRGVGWYIMALTDTLDYFPKKHQGRKRLLKYLETLADALVACQDKATKGWWLVMDP
GLEHKSGNYIESSGTAMFVTSLFKAIRMGYIKGDRYLKAALDGYTLMATSFAQPRPHDGS
LAWEWTVQTGSLSSNGTFEYYASMPLFENDLKGVAPFLFSSYEYELYRTKASV

Enzyme Prediction     

No EC number prediction in FPRN_13126-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	405	6.2e-91	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	4.22e-65	49	405	17	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	3.29e-60	65	406	36	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI86988.1|GH105	2.03e-310	1	412	1	412
QGJ00525.1|GH105	4.78e-309	1	412	1	412
QGI69637.1|GH105	4.78e-309	1	412	1	412
CCT74193.1|GH105	1.37e-308	1	412	1	412
QKD61168.1|GH105	8.36e-294	1	412	1	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.99e-73	45	405	3	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.31e-51	65	405	41	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.77e-51	65	405	31	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	3.75e-09	52	403	69	409	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.19e-50	65	405	41	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	3.96e-21	197	403	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	3.96e-21	197	403	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|O31521|URHG1_BACSU	7.91e-08	73	342	39	288	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000310	0.999674	CS pos: 17-18. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in FPRN_13126-t42_1-p1.