CAZyme Information: FPRN_13081-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_13081-t42_1-p1
• CAZy Family: GH76
• CAZyme Description: related to class I alpha-mannosidase 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60740.05	4.7383

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000066:60545-62173(-)

Full Sequence      

MLFSLVLCTFVLSAFASPSTPISEQKLGGLRYPKQRGKHYDYTGFEPNQKKRADDIIDMF
RFAWNGYYEHAFPHDSLRPKYSNYSDDRNGWGVTAVDGLDTAILMEQTDIVEIILDFIPT
INFTKTNTPKPTSVSLFETNIRYLGGLLSAYDLLKGPFKHLKVNKDNVDALLKQATTLAD
TLKFAFDTPSGIPFGSLWIENQTSTNEDSLEDGTAYAGLAAMGTLVLEWQHLSDLTGDPE
YGKLANRAESYWLSPSSEVWPGLTGGRFSLKTGEILDEYGGWTSGNDSAYEYLIKMYVYD
PDRFSHYGERFTLAADSTIKHLISHPSSRPDLTMAAAFTGKQQVNYTEFLACFIGGSFIL
GSSALDRPDWLDYGLSFSEYCANGYRYTASGIGPTLYSWDLNELAQPENKNQTLFYERAG
FFIQEGIFSGGQAPEAVESWYYAYQKTHDQYWRDVAWAYTLAQNRTMRVGGGFASINNVL
SPSGDGVRGGIMASFMLAETLKYMWLIQTENKGEWDVLEGGENLFVYNTEAHPLRVAAKK
PV

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	59	536	2.1e-109	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.65e-142	59	536	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.21e-75	50	539	70	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73980.1|GH47	0.0	1	542	1	542
QGI69595.1|GH47	0.0	1	541	1	541
QGJ00483.1|GH47	0.0	1	541	1	541
QGI86948.1|GH47	0.0	1	541	1	541
QKD60002.1|GH47	0.0	1	542	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	4.30e-152	48	537	2	474	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	7.08e-152	19	537	6	509	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1.03e-135	52	536	15	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	4.41e-41	49	536	20	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	5.13e-41	49	536	18	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31723|MAN12_PENCI	3.64e-151	19	537	6	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|A1CP08|MNS1B_ASPCL	1.46e-150	52	536	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	3.90e-147	50	536	37	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	8.63e-144	15	538	3	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	8.63e-144	15	538	3	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999748	CS pos: 16-17. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in FPRN_13081-t42_1-p1.