CAZyme Information: FPRN_12675-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_12675-t42_1-p1
• CAZy Family: GH6
• CAZyme Description: related to chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	FCQG01000029|CGC4	87675.52	7.9225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000029:314083-316494(-)

Full Sequence      

MATFHVPEADTTKRTSASWRSPTQQEKSYPPLPSFSTKVSNNKYVHRDNEGPFHDVSLGD
ILKRTSQDDARSSDDSIDPSLFTSSLSYKSSFAQTSVSQFSSNPPTKPNSPSLGESSRQR
DLIIPGPRLPYPVARRRDSGSVSSVEDASVQAVDYTATATQTSPRNSILEESTASAPRVE
IDSESQNLDEYLRKYGQRKVTRQKHIMTAFLISVNFMFIFASWWWPRYYYVYIPFISFPL
VLNCIMIASIICFTLKNLISAEKIIEPGHLEDLIMIMPCYNETLEECTKSLDSLVDQVGI
DNHKRGIMVICDGRVRGPGMEKTTAQYLNEDIFVEQLHREKITRAYRAWDGQAMDVEISW
GYYKGIPFYCIVKEQNQGKRDSLIVIRSFLYKFNIRNTNPTTIFSSQFLLSMTDWLTQEV
KVNQVDHLIGMDADTIFDKVCISELLKESKYPNTVGVCGYVAVDFKDGNWNLWSIYQNAE
YTIAQGLRRLHQSIATKKVSCLPGCCQLLKICDMTCGDKVLVELFGYYPRPLDGMITRIR
ATASEDRNHICQLLTTFPEAQTRQALRARAYTDVPHSWSVFLSQRRRWTLGATSNDLLLT
TARHCQWWERILAFSNVLTWCLNVFVIASIGCMIVAFMHQPWWIIMAFAGIMIVPLIYYV
IIAVWLPQSMLERFQYLLGLFIFVVLGPFLNIAVMVFAVFNMDSFGWGKTRKVIAETAED
QVHEKQRLEGSSSGSNSPQLKSGNSRVDETAGGVTVRRPTVVYVPPVTQLR

Enzyme Prediction     

No EC number prediction in FPRN_12675-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	373	725	6e-30	0.6698292220113852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	3.34e-32	274	716	28	498	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	2.72e-19	278	589	4	238	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	4.85e-11	276	508	2	160	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.41e-10	229	700	5	391	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	0.003	562	652	112	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI69223.1|GT2	0.0	1	771	1	771
QGI86587.1|GT2	0.0	1	771	1	771
CCT73604.1|GT2	0.0	1	771	1	771
QGJ00112.1|GT2	0.0	1	771	1	771
QKD59723.1|GT2	0.0	1	771	1	771

PDB Hits     

FPRN_12675-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	6.70e-25	273	722	409	868	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VNT4|CHS5_CRYNH	1.01e-23	240	732	1222	1725	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|J9VF17|CHS4_CRYNH	1.74e-22	240	722	475	967	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|O13353|CHS4_MAGO7	5.15e-22	270	716	682	1155	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2
sp|P29465|CHS3_YEAST	1.14e-21	274	713	655	1120	Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

Start	End
206	225
229	251
616	638
642	664
677	699