CAZyme Information: FPRN_12550-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_12550-t42_1-p1
• CAZy Family: GH53
• CAZyme Description: probable DUF1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		60748.58	6.0042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000062:81488-83225(-)

Full Sequence      

MSLRILASSLLGLSATLASASPDDEQRPLGDYHRICPDYTRYAAYPHRPFSTGPRELPYQ
RPSTKCRTFQSDAIEKVIEDVTSRMKDPDLARLFENAFPSTTDTTVKFHTKGKEDTGFFR
MGSFGGFHDEGAWQGPQSFIITGDIIAEWLRDSTNQLRPYQPLAKKDPAIHTLLLGAINT
QAEYVIESPYCNAFQPPPISDLPLSSNGQEDNVHPAYEPQAVFECKYELDSLAHFLALGN
DFHDHTGSTEFLTKRWYRAVETLMNVLTEQSKSTFDPKTGEFQRNEYTFSRRTDIGTETL
NLKGVGNPLNWGTGLVRSAFRPSDDATILGFFIPANAQMSVELKRASKILTTAGKSTLAQ
KLEAWSAKLREGIMEHGVVKHKKYGDVFAYEVDGYGSSILMDDANYPSLLALPLMGFCEV
NDPIYQNTRKMLLEKSGNPYYLEGDAFKGIGGPHIGLRNAWPMSLLIQARTSNDDKEIKD
CIELVLDSARLGLVHESIDVQHITQYTRSWFAWANGVFASTILDLAKRKPHLIFGEGAAP
YEI

Enzyme Prediction     

No EC number prediction in FPRN_12550-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	87	523	2.2e-162	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	87	523	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.31e-168	66	532	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	2.15e-06	329	502	412	581	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI69108.1|GH125	0.0	1	543	528	1070
CCT73488.1|GH125	0.0	1	543	1	543
QGI99996.1|GH125	0.0	1	543	528	1070
QKD59594.1|GH125	0.0	1	543	1	543
QPC71621.1|GH125	0.0	1	543	1	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.39e-98	61	525	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	3.41e-98	61	525	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	6.84e-95	61	525	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	4.54e-79	72	529	10	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	5.10e-79	72	529	10	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.41e-190	34	533	25	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999653	CS pos: 20-21. Pr: 0.9563

TMHMM  Annotations     

There is no transmembrane helices in FPRN_12550-t42_1-p1.