CAZyme Information: FPRN_12488-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_12488-t42_1-p1
• CAZy Family: GH51
• CAZyme Description: probable branching enzyme (be1)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		80190.30	6.1145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000010:1066998-1069516(-)

Full Sequence      

MAAIAENSSNSLDPNHSGGGAAGDIPNDGTGVVKLDPWLEPFSEALRRRFSKTQDWIKTI
NDTEGGLEKFSRGAEKFGFNVDADNNIIYREWAPNATAAFLIGDFNSWDRNAHPMAKNDF
GVFEITISAQGGQPAIPHLSKVKISLNLPNGEHVDRLPAWIKYVTQDLSVSPAYDAHFWN
PPASETYKFKNARPKKPASVRVYEAHVGISSPDQRVATYKEFTKNMLPRIKNLGYNVIQL
MAVMEHAYYASFGYQINNFFAASSRYGTPEDLKELIDTAHGLGITMLLDVVHSHASKNVL
DGINEFDGTDHHYFHGGGKGRHDQWDSRLFNYGHHEVMRFLLSNLRFWMDEYQFDGFRFD
GVTSMLYVHHGMGTGFSGGYHEYFGADVDEEAVVYMMLANEMLHALYPEVITIAEDVSGM
PALCLPVSLGGVGFDYRLAMAIPDMWIKILKELKDDEWDIGNICHTLTNRRHGEKTIAYA
ESHDQALVGDKTLMMHLCDAEMYTNMSTLSPLTPVIDRGMALHKMIRLVTHGLGGEGYLN
FEGNEFGHPEWLDFPREGNNNSFWYARRQLNLTDDPLLRYKFLDHFDRLMNQTEAKYGWL
HAPQAYISLKHEGDKVIVFERGGLVFIFNFHPTNSFSDYRIGIDVAGTYRVVLNTDSKDV
GGHSRVDENTRFFTTPMEWNNRKNWTHIYIPCRTALVLALESTISQQS

Enzyme Prediction     

EC	2.4.1.18:166	2.4.1.18:50

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	251	544	1.4e-152	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215519	PLN02960	0.0	134	700	332	891	alpha-amylase
200460	AmyAc_bac_euk_BE	0.0	184	588	2	406	Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes. Branching enzymes (BEs) catalyze the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage yielding a non-reducing end oligosaccharide chain, and subsequent attachment to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. This group includes bacterial and eukaryotic proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
215246	PLN02447	0.0	7	700	37	730	1,4-alpha-glucan-branching enzyme
178782	PLN03244	9.23e-171	134	700	337	866	alpha-amylase; Provisional
223373	GlgB	2.40e-134	87	700	38	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI86417.1|CBM48|GH13_8	0.0	1	708	1	707
QGI69049.1|CBM48|GH13_8	0.0	1	708	1	707
QGI99938.1|CBM48|GH13_8	0.0	1	708	1	707
QKD59535.1|CBM48|GH13_8	0.0	1	708	1	707
CCT73432.1|CBM48|GH13_8	0.0	1	708	1	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BZY_A	3.41e-311	32	698	31	695	Crystal structure of human glycogen branching enzyme (GBE1) [Homo sapiens],4BZY_B Crystal structure of human glycogen branching enzyme (GBE1) [Homo sapiens],4BZY_C Crystal structure of human glycogen branching enzyme (GBE1) [Homo sapiens]
5CLT_A	3.09e-308	39	698	6	663	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose [Homo sapiens],5CLT_B Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose [Homo sapiens],5CLT_C Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose [Homo sapiens],5CLW_A Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose [Homo sapiens],5CLW_B Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose [Homo sapiens],5CLW_C Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose [Homo sapiens]
3AMK_A	5.10e-269	32	696	13	688	Structure of the Starch Branching Enzyme I (BEI) from Oryza sativa L [Oryza sativa Japonica Group]
3VU2_A	1.45e-268	32	696	13	688	Structure of the Starch Branching Enzyme I (BEI) complexed with maltopentaose from Oryza sativa L [Oryza sativa Japonica Group],3VU2_B Structure of the Starch Branching Enzyme I (BEI) complexed with maltopentaose from Oryza sativa L [Oryza sativa Japonica Group]
7ML5_A	1.99e-268	32	696	12	687	Chain A, Isoform 2 of 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y8H3|GLGB_EMENI	0.0	26	704	6	684	1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=be1 PE=2 SV=3
sp|Q8NKE1|GLGB_RHIID	0.0	31	699	15	681	1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) OX=747089 GN=GLC3 PE=2 SV=2
sp|Q96VA4|GLGB_ASPOR	0.0	26	704	11	689	1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gbeA PE=2 SV=1
sp|Q6CCT1|GLGB_YARLI	0.0	32	701	5	685	1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GLC3 PE=3 SV=1
sp|P0CN83|GLGB_CRYNB	0.0	27	700	7	682	1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GLC3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRN_12488-t42_1-p1.