CAZyme Information: FPRN_12325-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_12325-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: related to 6-hydroxy-d-nicotine oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497		54585.52	8.0541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000010:569404-570994(+)

Full Sequence      

MMVSFLLICLHAALAFAASTSPANTSTALNNCLASKKVPYIRPNSAQWTQEVRPYNLRLA
YTPAAIALPTTVDHVQDAVKCGNQYQVRVSAKGGGHSYGSFGYGGENGHLVIVMDSMDQV
TLNKYMSCNIQAGARLGHVASELYKLGQRAIPHGSCPGVGIAGHALHGGYGFASRTYGLT
LDTFIGATVILANGTRTYAADGEGGDDQLMWALRGAGSSYGIVVELDFQTIKAPDTVTPF
NIELEWDENQAVEGLIAFQKFAVNAPKQLNMQIYIGPSGQTIQGVYYGTRTALNNALKPL
LGDIKAQISASSTGGWIEGLKAYANGQNLDQRRPYDQHSTFYSTSLMTIALTRSQVKSFV
RTLFDNINDRDARHSWYILIDLFGGPNSAITTAGSTNSAFPHRDKLLLFQFSDHGNYATH
AKNGFTLLKRFRESITKTMDDSQWGMYANYLDTQLDNLDAVEQYYELNLGRLRELKRTYD
RNDMFWNPQGIRPATRG

Enzyme Prediction     

EC	1.1.3.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	54	491	6.1e-76	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	5.39e-25	63	195	1	134	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	8.17e-21	61	494	30	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	8.31e-10	447	492	2	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
183043	PRK11230	5.98e-04	50	237	39	234	glycolate oxidase subunit GlcD; Provisional
273751	FAD_lactone_ox	0.004	69	194	21	144	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68899.1|AA7	0.0	2	497	1	496
QGI99788.1|AA7	0.0	2	497	1	496
QGI86269.1|AA7	0.0	2	497	1	496
CCT73375.1|AA7	0.0	2	497	1	496
QKD59370.1|AA7	0.0	2	497	1	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YJO_A	3.57e-273	6	494	7	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6Y0R_AAA	4.51e-136	28	493	26	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	4.49e-129	18	494	16	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	1.45e-112	28	494	2	472	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	1.43e-111	29	493	9	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K2|CHITO_GIBZE	2.32e-135	28	493	26	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	4.21e-129	28	496	28	494	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|G2QG48|XYLO_MYCTT	2.31e-128	18	494	16	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	9.52e-128	28	496	28	494	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|I1SB12|MNCO_MICNN	5.17e-112	18	494	14	494	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999732	CS pos: 17-18. Pr: 0.9672

TMHMM  Annotations     

There is no transmembrane helices in FPRN_12325-t42_1-p1.