CAZyme Information: FPRN_12018-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_12018-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		40138.37	9.3381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000019:752028-753254(+)

Full Sequence      

MSQDKVSARLLTTAVFMTGILVFLALPFLPGRPKQHVVRPVKISLHSEEPNEPNEPNEPN
ERFLVAFGDSYSRSGFRTNYTYIRTGPGVDDMQRTERPKGDRVDAPSALNPIGNPALPGN
TSSGGYNWATYMTTEFNSTLTLAYIFARSASVVDAEIIPSRSKSSFSFAQQIVHFQDAIG
HRPHYAAWTAKNIVVTVWFGFNDLSVVSHKRGQAAVLAAANRRIFELSQILYDTGIRNFV
FIEVPPKELFPSHQAHKSNDTHHSYEMVSYAVNRWNSLLRQNTVRFRKTHPDAKATYVEI
WDIFYEAFLRPQDLGAPNSTCVDPSGKGCLWANTGHPGEEIHKLIGARVAEKAWGKAAM

Enzyme Prediction     

No EC number prediction in FPRN_12018-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	64	349	1.2e-53	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.01e-31	64	351	2	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.30e-10	146	329	80	265	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.86e-10	158	349	50	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73030.1|CE16	6.58e-253	1	359	1	362
QGI85829.1|CE16	1.37e-251	1	359	1	368
QGI68638.1|CE16	1.37e-251	1	359	1	368
QGI99528.1|CE16	1.37e-251	1	359	1	368
UPL04243.1|CE16	1.21e-81	42	355	34	326

PDB Hits     

FPRN_12018-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.49e-55	62	354	32	297	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.49e-55	62	354	32	297	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000004

TMHMM  Annotations     

Start	End
7	29