CAZyme Information: FPRN_11935-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_11935-t42_1-p1
• CAZy Family: GH47
• CAZyme Description: ATH1-Acid trehalase, vacuolar

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1043		114690.82	5.3335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000019:548658-551992(+)

Full Sequence      

MLSSYLSYVILTLLSSITLATSTHDHDRIKKCYQRHSSSNHSAKASENIYKTSFPGVTWD
NDNWLLSTTNLDQGHYQSRGSVANGYLGINVAAAGPFFEIDLDEEGGVINGWPLFSRRQT
FATIAGFYDAQPNTNGTNFPWLLQYGYESVISGVPHWSGLILDLGDDVYLDARVDNRTVH
NFTSTYDFKAGVLEWSYTWKPKAQKGAYEIKYRLFAHKLHVNQAIVDLTVVPTIDSEATI
VNVFDGYSAVRSDFVKSGEDDDGAIFSAVRPVGIANVTAYIYAQVSGSKSLDQSRRKLVH
GKPYVHTNESSIAQAIPVKFSAGVPVHITKYVGAASSDAFDDPEKTAKEASRKAMEEGYE
KSLLSHVKEWQSVMPSDSVDSYAFPENNTLPDDEYIIDSSIIAVTNTYYLLQNTVGKNAQ
KAVSGAPVNVDSISVGGLTSDSYAGLIFWDADLFMQPGLTTSHPEAAQRITNYRVAKYDQ
AKKNIATSYAGSQNETKFSDSAAVYPWTSGRFGNCTATGPCWDYEYHLNGDIGISLVNQW
VTSGDTDFFKETLLPIYDSVANLFTDLLKPNGSSWTITNMTDPDEYANHIDAGGFTMALA
SETLIQANKIRRQFGMTENKTQDEIASDVLFIRENGITLEFTTMNGSAIVKQADVVLMSF
PLGYNDNYTDQNGLDDLDYYANKQSPDGPAMTWAIYSIVADELSPSGCSAYTYAQYSYKP
YTRPPFYQLSEQLVDNATTNGGTHPAYPFLTGHGGANQVTIFGYLGLRLIPDQGLHVNPN
LPPQIPYLKYRTFYWRGWPISAWSNYTHTVISRHQTTKPLDVADSRYANKSIALYAGKQG
DSALHHLTFDEPVVIKNREIGSVNTVQGNLAQCRSVKSPNSYEPGQFPLAAVDGATSTKW
QPSRAAEISSLTVSLAKKDVGSKVKGFYFDWADAPPVNVTVLFHNKTIDDPAKVFGTWSH
DSGYDIVVSIKRVKLSDAYNAKTDDLDAVVMPTGNTTNVTLPEPVPLSRYATLLIAGNQA
LDKVDLKAGNGTGATVAEWAILH

Enzyme Prediction     

EC	3.2.1.28:5	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	406	769	3.7e-79	0.9838709677419355

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	5.09e-68	62	797	9	726	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
397616	Glyco_hydro_65N	2.93e-41	72	337	9	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
281612	Glyco_hydro_65m	2.38e-26	406	773	3	386	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
237517	PRK13807	5.74e-07	155	604	85	504	maltose phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73100.1|GH65	0.0	1	1043	1	1043
QGI68555.1|GH65	0.0	1	1043	1	1043
QGI99446.1|GH65	0.0	1	1043	1	1043
QGI85751.1|GH65	0.0	1	1043	1	1043
QKD62118.1|GH65	0.0	1	1043	1	1043

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	4.45e-39	62	784	22	657	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	9.93e-21	432	797	326	722	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	7.33e-13	306	816	215	719	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.48e-11	306	816	215	719	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78617|TREA_EMENI	0.0	20	1042	21	1037	Acid trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treA PE=3 SV=1
sp|D4B5H9|ATC1_ARTBC	0.0	6	1043	8	1052	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1
sp|M1RNJ8|ATH1_CANGB	6.11e-113	44	949	145	1065	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|Q5AAU5|ATC1_CANAL	2.68e-108	76	941	121	964	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|N1P212|ATH1_YEASC	8.37e-107	44	950	109	1045	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000346	0.999633	CS pos: 20-21. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in FPRN_11935-t42_1-p1.