CAZyme Information: FPRN_10892-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_10892-t42_1-p1
• CAZy Family: GH32
• CAZyme Description: related to choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	FCQG01000048|CGC2	68829.58	4.5118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000048:119557-121479(-)

Full Sequence      

MRHAFFAGLLAAPASVCAVALTGYEYIVVGSGAGGGPLAARLALAGHKTLLIEAGDDYAS
LNYTVPAYSANASEDPEISWNFFVRHYADDERQARDYKTTYDTPNGEYTGLNPPEGAEMK
GTLYPRTQALGGCTAHNALIAVYPHQSDFEYIASLTGDDSWSADNMRKYFVKAEDNNYRP
AGEAGHGYDGWLSTETAPLSIPLNDEQLFSILGGGAVALTEMSGKNITLDGLLADDANAD
TLARDQEAGFYQIPLSTKDASRIGPREFILSVRDAKHPNGTKKYPLDVRTNCYVTKVTFD
DSKPPRANGVEFLDGKHLYKASPLATGAAGTPGNATASREVVVAGGVYNTPQILKLSGIG
PADELKKFDIPVVSDLPGVGTNLQDHYEISVQGTLENNFTSFDGCTFGLYTDEDPCVDRW
RAPVDGDHGIYSSSGLAASMFYKSSTAEKDNFDIFAFGGPVNFRGYFPQYAVNATIEHNW
FSWAILKAHPRNTAGEVLLKSADPLDMPAITFNYFDTGNGDSSADLQALYEAVELTRSAL
ANQPVNVTEVLPGAGVTSQKDIETYVKDVAWGHHASSTCPIGADDDKMAVLDSKFRVRGV
AGLRVVDASVYPRIPGTFTAVSTYMVAEKAADVMLAELEE

Enzyme Prediction     

No EC number prediction in FPRN_10892-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	636	4.4e-97	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.91e-73	24	635	6	532	choline dehydrogenase; Validated
225186	BetA	1.79e-68	24	637	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.09e-31	495	630	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.27e-21	24	617	56	559	Protein HOTHEAD
366272	GMC_oxred_N	8.37e-16	122	388	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI67549.1|AA3	0.0	1	640	1	640
CCT71796.1|AA3	0.0	1	640	1	640
QGI98432.1|AA3	0.0	1	640	1	640
QKD59010.1|AA3	0.0	1	640	1	640
QGI84776.1|AA3_2	0.0	1	640	1	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	5.10e-44	24	631	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	6.96e-44	24	631	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	6.96e-44	24	631	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	6.96e-44	24	631	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	8.61e-44	24	631	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1CFR7|BETA_YERPN	7.12e-53	24	632	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	7.12e-53	24	632	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	7.12e-53	24	632	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.35e-52	24	632	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|A7FKL6|BETA_YERP3	1.35e-52	24	632	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.085464	0.914513	CS pos: 18-19. Pr: 0.8773

TMHMM  Annotations     

There is no transmembrane helices in FPRN_10892-t42_1-p1.