CAZyme Information: FPRN_10177-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_10177-t42_1-p1
• CAZy Family: GH3
• CAZyme Description: related to acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202		22844.56	4.8916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000008:1026456-1027116(-)

Full Sequence      

MAPSSSWNLTEIVSGNEVVWAGTEKTTGDMKDGHFAAWSGKTVQYINDHIDPSLEQRPNL
ILIHAGTNDMNSNRHISTDGNIPQDTTNRLRSLVEKMMSKCPDATIIISMITDVCDNEWY
HFQREGIKIYRQHIAELAAELRANGSHVLAADFGPFDDTLLSDCVHPTQKGYEILGHWWY
DYIHQIPEGWIKDPVGLDPVRD

Enzyme Prediction     

No EC number prediction in FPRN_10177-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	15	183	5.8e-32	0.8350515463917526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.28e-37	32	183	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.27e-19	35	174	38	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.02e-12	36	182	41	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238879	NnaC_like	2.75e-09	42	183	36	174	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
395531	Lipase_GDSL	8.56e-09	43	179	64	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71135.1|CE0	1.24e-147	1	202	104	305
QGI66858.1|CE0	1.24e-147	1	202	104	305
CEF83009.1|CE0	1.58e-65	9	199	77	262
QPC73171.1|CE0	1.75e-64	9	199	77	262
UKZ47743.1|CE0	1.23e-63	9	202	92	282

PDB Hits     

FPRN_10177-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRN_10177-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRN_10177-t42_1-p1.