CAZyme Information: FPRN_10075-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_10075-t42_1-p1
• CAZy Family: GH3
• CAZyme Description: related to beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		43851.70	8.0703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000008:1307546-1308670(-)

Full Sequence      

MVPKAVFRGILVIGICSLLWWTFRPFRGSRAVFTESLQSIDLLSPTSHHGRKTSELYASR
AAHDLCSAHGYSAFVPKSPSSERKVYDMLMINDELDFLEIRLDALYDYVDYFIIVESAKS
FQANSKPLILKENWDRFRRYHHKIIYHKLVFPSSFDPHRAWDYEDLQRDAPFDQVLLSLE
GPRAPNKGDVLIVADVDEIPRPQTLLVLQYCDFPRRLTLSSKFYYYSFQFLHTGPEWQHP
QATYYQGHRTLKPTNLRNGDGGFRPFRFLERDVLTNAGWHCSSCFPTIDQFLNKMSSFSH
RWMNREEYRDRDKIAAAVREGKDLWGREQDQFVRIEDNKDMPSLVLNEPNRFGYMISRDG
PSAGFVDYNRKEKS

Enzyme Prediction     

No EC number prediction in FPRN_10075-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	63	355	2.2e-79	0.9788732394366197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	2.65e-49	61	326	56	300	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71044.1|GT17	1.50e-274	1	373	1	373
QGI83999.1|GT17	1.50e-274	1	373	1	373
QGI66762.1|GT17	1.50e-274	1	373	1	373
QGI97648.1|GT17	1.50e-274	1	373	1	373
QKD58150.1|GT17	4.51e-261	1	373	1	373

PDB Hits     

FPRN_10075-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRN_10075-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999029	0.000989

TMHMM  Annotations     

Start	End
5	23