CAZyme Information: FPRN_09843-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_09843-t42_1-p1
• CAZy Family: GH3
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	FCQG01000006|CGC4	54142.39	7.4540

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000006:1565064-1566910(-)

Full Sequence      

MVYILLLASLAVGSSVLAAPNYAVPDAQPENAVGIDPTPVGASFEFFMWPSYMTNISLTL
PCIDHFNKLYNRKMPIRIGGTTQDRATYDPAFKGYVSYSVDDPLEAPMSLTYGPKFFDLI
KKLGSDTILGFNRGLNNRTNTFSAILKAKEKVAKYLWAIELGNEPDLYWKYWQYPVAEAP
WNETQEGGNAADWAQDFINHWKSPLPILAGGGYAIPFEIEPNWPNLPYLIETSYNKTVKD
ATKVYNGHLYAFSNASAEDLGPEMKHQRVVQDLSLLPISSAKSVGRSYILGETGFHGLDY
EMDSTFGSAIQTTDKTLRALTLGIQRLFYHQGTINQAFFNWWWSDHVNAPFYGAYFGALA
VAGGDSIVASDNGTDPYAQYIIYKNGKAFKAVLINTDYYSGSGKRSETKFTLSGLRTNLV
QALRMTGPTSETTVPIIQTKSSPQPSIGGQSFSNKNCKLSGKQNTEKFSVKKGKLEVTLK
ASEALIVYL

Enzyme Prediction     

EC	3.2.1.31:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	40	411	3.5e-35	0.8483516483516483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.40e-18	380	486	2	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT70706.1|GH79	0.0	1	489	1	489
QGI83786.1|GH79	0.0	1	489	1	489
QGI97434.1|GH79	0.0	1	489	1	489
QGI66544.1|GH79	0.0	1	489	1	489
QKD56667.1|GH79	0.0	1	489	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	2.45e-75	21	489	4	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	1.47e-18	40	395	54	436	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	4.44e-14	15	362	15	385	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999716	CS pos: 18-19. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in FPRN_09843-t42_1-p1.