CAZyme Information: FPRN_09826-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_09826-t42_1-p1
• CAZy Family: GH29
• CAZyme Description: related to glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	FCQG01000006|CGC7	55781.08	6.6333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000006:1522912-1524618(-)

Full Sequence      

MKLSETMQPSQVLATKRKLPISESQYTNGAKRNGTERTKADMKKSLSSEYKHVELLFSPS
VEMKIWAVAERSLNMPEPPTWFPEYTKPGSTEYVYRDASFWTSGFFPGLLYLIMERRKKF
QTELRLLGLSRPKPDFPHTIQLEYASKWWTENLHQNGSLMGTHDLGFMICPWARLQWDLN
RDLKAFDTSMTAANTLADRFSDKVGCIRSWDVCQTKVYSFTDPSKDFLVIIDNMMNLDLL
FWAASEASSQAESTRFFDIAMAHARTSREYLIRADWSSYHVANFDPSTGALKERLTNQGY
SHTSCWSRGQAWAIAGFAKSYEWSGESSFLDTAKNCADYFLRRLPDTHIPPWDFDAQDES
AATQPPDTSAAMVAAYGMLLIHQSLQNRSEASPYLDHALRIVDAVCERHLNPAASQKQDL
GTIPTVENGRATVVKCVETAAGLGDTILNGATINNFEFAPRRWADHGLVYADYFFVLFGN
KLLEMNALRSLA

Enzyme Prediction     

No EC number prediction in FPRN_09826-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	96	476	4.6e-94	0.9696048632218845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	1.94e-08	234	485	132	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI97417.1|GH88	0.0	1	492	1	492
QGI66527.1|GH88	0.0	1	492	1	492
QGI83769.1|GH88	0.0	1	492	1	492
CCT70691.1|GH88	0.0	1	492	1	492
QKD56650.1|GH88	0.0	1	492	1	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VD5_A	1.22e-41	82	405	24	317	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	6.24e-41	82	405	24	317	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	3.23e-38	84	393	49	326	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.29e-38	84	393	50	327	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	1.65e-37	84	393	50	327	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RC92|UGL_BACGL	6.26e-41	82	405	24	317	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|T2KLZ3|PLH1_FORAG	1.01e-40	101	476	77	388	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.69e-37	84	393	50	327	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	2.25e-37	84	411	48	347	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.56e-35	92	393	61	328	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FPRN_09826-t42_1-p1.