CAZyme Information: FPRN_09747-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_09747-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	FCQG01000006|CGC1	76635.10	4.8610

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000006:1331526-1333538(+)

Full Sequence      

MKTLTGPSALMPLFALLTCAQNTNILEQHFGNDTDWYRDRVPIFECSDKSITDVYYYRWK
IFRTHQRNVGSNGFISTEFLDNVGWQNKDWASLNDASIFHLNEGRWCRDPRYKQDYAMFM
YSKNSNPRQYTEAMAAGVWNNYLVDGDPELSLSLLQSMQDNYEAWIKERFDESKGLFWIA
PLQDATEYTIGSIDASGGRDGFTGGETFRPTFNSYQIANARAIANIAKIKGDQAVVDKYN
DRAAALKKRMQDDLWNSTFNHFVDRYYVDNEFVKYWAPIRGRELAGMVPWTHDVPDDSEE
YSKALQHIIDPERLAGPFGLRTVEPSYEHYMQVWRYEGDHVECHWNGPSWPYQTTQVLTA
LGNILDHYPTSAKAVSVKNYISLLKQYATQHYNKDYGTLDLEENYDPDTGYPIVGLGRSH
HYFHSGYIDLILSGFVGIRPRQDDVLEVHPLVDTEEISYFRAENVLYHGRNVTVQWDKMG
NKYGEAGLKVQVDGQDVGSSDKLERLEIKLEREIVPVYRPIAKSIPLQADSSSPKVSSSI
PNADQQRVHDVFDGRIWFWPEATIVNGFDTPEGNADEQWVSIDFGSDQQAKRAEIAFYEN
AEQGFDVPASYRVQINDDGWKDVSGADYGKTVANGITKASWSAASAGTWRIVVKPQEGSR
TRLVEFSLFE

Enzyme Prediction     

No EC number prediction in FPRN_09747-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH142	32	505	1.7e-171	0.9624217118997912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	1.63e-05	294	432	361	489	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
225942	GDB1	0.003	237	354	444	541	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
395611	F5_F8_type_C	0.007	559	625	12	82	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI66469.1|GH142	0.0	1	670	1	670
QGI97357.1|GH142	0.0	1	670	1	670
CCT70624.1|GH142	0.0	1	670	1	670
QGI83711.1|GH142	0.0	1	670	1	670
QMW48567.1|GH142	8.26e-275	25	669	24	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQS_A	2.70e-78	34	506	651	1101	Sialidase BT_1020 [Bacteroides thetaiotaomicron]
5MQR_A	3.78e-75	34	506	651	1101	Sialidase BT_1020 [Bacteroides thetaiotaomicron]
6M5A_A	1.57e-18	36	552	305	856	Crystal structure of GH121 beta-L-arabinobiosidase HypBA2 from Bifidobacterium longum [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH9|HYBA2_BIFL2	1.13e-17	36	552	336	887	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.030392	0.969550	CS pos: 20-21. Pr: 0.9091

TMHMM  Annotations     

There is no transmembrane helices in FPRN_09747-t42_1-p1.