CAZyme Information: FPRN_09590-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_09590-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: related to DUF1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		57170.61	7.4106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000006:931230-933205(-)

Full Sequence      

MKFLSAVTGAIALLQSADAATWKDYKPQSRTPSSCPDYVDYSQKPHKPLSSGKLKLPFMR
PSEECRTFKSPAKVISDIKKRVKNPDLARLFENTFPSTLDTTVKYFDAKKNLAFIVTGDI
TAQWLRDTGNQFAHLYKLMPQDKNLQALVKAIINTEARYISEYPYCGSFQPPPESGLSPS
VNDYATLVTVNPPVDNQTVFECKYELDSLAGFLKITRSYYDNTKDASFINDNFKSAMKQI
LRVIDEQSQGTWAEDWSYISYYNWTGQAGSLSPPVPNSGNGEPKLANGLVACSHRPSDDI
SVFNYITSDNAMMSVELDNVANVLDKVGGQKGLSTTLRGHAETIRQAVWNHTLTANGIFA
YETNGYGGQYIMDDANVPSLVSLPYLGFLKRDDPTYKKTKSALFSRANPYYAVGKKFSGI
GGPHANATNPWPMAHVSAIYGTDDDNEITERLNMIMENTAGLGLIHESVNIYNSSVFTRP
WFAWANSYFAEMVLDLAKRKPGLIFKDDKPYVI

Enzyme Prediction     

No EC number prediction in FPRN_09590-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	84	494	9.8e-129	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	84	494	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.19e-118	65	503	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI97220.1|GH125	0.0	1	513	1	515
CCT70783.1|GH125	0.0	1	513	1	515
QGI66334.1|GH125	0.0	1	513	1	515
QGI83576.1|GH125	0.0	1	511	1	513
QKD56441.1|GH125	0.0	1	513	1	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	4.63e-73	60	496	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	9.48e-73	60	496	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	7.33e-72	60	496	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	6.44e-62	73	495	14	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	3.45e-61	73	495	14	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.66e-126	34	507	26	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000341	0.999634	CS pos: 19-20. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in FPRN_09590-t42_1-p1.