CAZyme Information: FPRN_09546-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_09546-t42_1-p1
• CAZy Family: GH27
• CAZyme Description: probable chitosanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	FCQG01000006|CGC2	24576.96	4.8530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000006:824857-825659(+)

Full Sequence      

MHSCSFLTAVTLGTAASAYQLPQNLESIYDSHKAGSCSNRLSDRFPEGARYCGDISGAIY
LKGSNGNYDNMDIDCDGANNHAGACSNDPSGQGETAFKDTVKNYGIPDLNANVHPYVVFG
NDGASPSFDPQQHGIKPLSVMAVVCNGEHYGIWGDTNGGTSTGEASISLAELCFPNQGLN
GDNGHGEKDVLYIAFKGDEAVPGKNGADWKAASRADFSKSIRTLGDKLVAKLQG

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	7	230	3e-83	0.9818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.25e-100	71	231	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI66296.1|GH75	2.15e-172	1	234	1	235
QGI97180.1|GH75	2.15e-172	1	234	1	235
QGI83540.1|GH75	5.07e-171	1	234	1	235
CCT70428.1|GH75	1.65e-155	1	234	1	252
QKD56405.1|GH75	4.15e-150	1	232	1	227

PDB Hits     

FPRN_09546-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	4.92e-104	16	232	16	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	1.73e-99	5	233	4	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.98e-97	5	233	4	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U3M5|CSN_ASPOR	7.17e-95	7	233	6	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	7.17e-95	7	233	6	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000727	0.999259	CS pos: 18-19. Pr: 0.9602

TMHMM  Annotations     

There is no transmembrane helices in FPRN_09546-t42_1-p1.