CAZyme Information: FPRN_08827-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_08827-t42_1-p1
• CAZy Family: GH18
• CAZyme Description: related to endoglucanase c

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		32328.57	8.6413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000035:288488-289474(+)

Full Sequence      

MRTAAFVTLLASVVSASPFGQRSQVLARASETCPVVFDGRVPANASLTDFDTANGGGWNP
YNPGFVKGNNISWSEILQLPKTKTKSRFDTEAGTIPLEVTISDKSIFMKQLGFRRAGLQF
NKDSNEGSPGSKGVKTLHFSIMQDDKRPLNLSHEYLNVWHEKADFSGNQFQFQAGQLIGQ
NGTAATWKLLDQDFKLLWETPMLKKVWQNFAITLNYEKNTIQAYYSKGCKPLKVATQPIA
RNLTGQGQFQIGILKKPTGTDDVANSGFQEANLNEGLIYGGIFLEDSADGCVSL

Enzyme Prediction     

No EC number prediction in FPRN_08827-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	35	290	2e-67	0.9725490196078431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.13e-99	35	290	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55659.1|GH131	7.96e-216	1	294	1	294
QGI96469.1|GH131	2.28e-215	1	294	1	294
QGI65589.1|GH131	2.28e-215	1	294	1	294
QGI82835.1|GH131	2.28e-215	1	294	1	294
CCT69757.1|GH131	7.64e-214	1	294	1	294

PDB Hits     

FPRN_08827-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

FPRN_08827-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000298	0.999661	CS pos: 28-29. Pr: 0.6128

TMHMM  Annotations     

There is no transmembrane helices in FPRN_08827-t42_1-p1.