CAZyme Information: FPRN_08421-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_08421-t42_1-p1
• CAZy Family: GH17
• CAZyme Description: related to spore coat protein SP96 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	FCQG01000015|CGC2	42120.99	4.4127

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000015:397204-398421(+)

Full Sequence      

MPSLLSTLSILALTATQASSHVIMVEPHPFNLDTEPLYQTWPLSEDLPFPCQGRTQHPEQ
VTKVTAGTTQLVKFWGSAVHGGGSCQFSVAYGKEPPKDPKKWHTIYSIIGGCPAEAEGNI
VSTGTDSHGRENGKECGNDTGKECTKQFNIPVPKDMQNGPATFAWTWFNKIGNREMYMVC
SPIEVVGGKDDSSYVDTLPAIFRANIPGECTTGASGSVINFPEPGDFGKIYEQGTPGSEG
TCAKGVEPNFKDDTAAPEPEKPAESGSPAPAQPSAPSPAPEQPSAPVEGAPAAPSAPVQP
SAPVPAPEQPSAPAQPSAPASPSSMVTMPSTPAQPTDAPAPIDSAKPEAGAPAWSGEFQA
CPSDVKSGMMHCFSETSWGICNGGWAFVSKVAEGTKCIDGAIAAE

Enzyme Prediction     

No EC number prediction in FPRN_08421-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	227	1.7e-63	0.9476439790575916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236090	PRK07764	6.90e-12	255	356	404	505	DNA polymerase III subunits gamma and tau; Validated
237865	PRK14951	1.45e-11	236	353	366	484	DNA polymerase III subunits gamma and tau; Provisional
236090	PRK07764	2.30e-11	234	353	392	506	DNA polymerase III subunits gamma and tau; Validated
236090	PRK07764	1.63e-10	263	353	389	480	DNA polymerase III subunits gamma and tau; Validated
237865	PRK14951	4.38e-10	250	368	364	469	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69101.1|AA11	2.44e-244	1	405	1	409
QKD55128.1|AA11	8.05e-238	1	405	1	360
QGI65138.1|AA11	1.06e-236	1	405	1	401
QGI96022.1|AA11	1.06e-236	1	405	1	401
QGI82391.1|AA11	1.06e-236	1	405	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	1.09e-35	21	227	1	198	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

FPRN_08421-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999737	CS pos: 20-21. Pr: 0.9384

TMHMM  Annotations     

There is no transmembrane helices in FPRN_08421-t42_1-p1.