CAZyme Information: FPRN_08376-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_08376-t42_1-p1
• CAZy Family: GH16
• CAZyme Description: Putative endoglucanase type K

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		39260.82	8.2595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000015:518678-519855(+)

Full Sequence      

MRSYTLLALAGPLAVNAASGSGHSTRYWDCCKPSCSWSGKAAVNAPALTCDKNDNPISNT
NAVNGCEGGGSAYACTNYSPWAVNDELAYGFAATKISGGSEASWCCACYALTFTTGPVKG
KKMIVQSTNTGGDLGDNHFDLMMPGGGVGIFDGCTSEFGKALGGAQYGGISSRSECDSFP
ELLKDGCHWRFDWFENADNPDFTFEQVQCPKALLDISGCKRDDDSSFPAFKGDTSASKPQ
PSSSAKKTTSAAAAAQPQKTKDSAPVVQKSSTKPAAQPEPTKPAEKPQTDKPVATKPAAT
KPAQPVNKPKTTQKVRGTKTRGSCPAKTDATAKASVVPAYYQCGGSKSAYPNGNLACATG
SKCVKQNEYYSQCVPN

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	22	220	4e-87	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.36e-118	21	220	1	214	Glycosyl hydrolase family 45.
197593	fCBD	7.37e-07	338	374	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.99e-04	339	370	1	29	Fungal cellulose binding domain.
234818	PRK00708	2.02e-04	235	339	98	205	twin-arginine translocase subunit TatB.
225629	FtsN	3.89e-04	238	320	108	190	Cell division protein FtsN [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN23441.1|CBM1|GH45	2.80e-255	1	376	1	376
AAO30278.1|CBM1|GH45	1.62e-254	1	376	1	376
AAA65589.1|CBM1|GH45	9.37e-254	1	376	1	376
QKD55086.1|CBM1|GH45	1.00e-248	1	376	1	376
CCT69059.1|CBM1|GH45	1.57e-244	1	376	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	2.08e-123	1	230	1	232	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	3.75e-114	18	230	1	211	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	4.31e-114	18	230	4	214	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1OA7_A	1.59e-108	21	231	2	210	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
1L8F_A	2.88e-107	21	227	2	206	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	1.66e-254	1	376	1	376	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	2.98e-105	22	229	3	209	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	2.83e-80	1	221	1	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	8.08e-58	19	219	37	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P54424|GUN1_USTMA	4.16e-41	6	232	9	247	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999748	CS pos: 17-18. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in FPRN_08376-t42_1-p1.