CAZyme Information: FPRN_07091-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_07091-t42_1-p1
• CAZy Family: GH142
• CAZyme Description: related to acetylxylan esterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		24611.63	7.8262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000044:190470-191306(-)

Full Sequence      

MLKMAFLASLFFIPLAIGAPAVDIEERQAPCQNVHIFLARGTDEPYPGRQSALVSAICSG
LPSCGYENINYPANFNTYCTSIYAGITGGLSQITAYANRCPDSKLVLSGYSQGAQLFGDM
LGGGGGQSLGCTQQSNSALNPATSPGNKIAAVLFFGDPRHAASQAYNTGTGASRNGINPR
NGAQLTSLNRYSNKIRSWCLAGDNVCAQGTDPSAHTSYFNVFSQEAGAWVKTMV

Enzyme Prediction     

No EC number prediction in FPRN_07091-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	232	1.3e-42	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.04e-30	30	231	1	170	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT68028.1|CE5	3.86e-168	1	234	1	234
QGI63982.1|CE5	2.23e-167	1	234	1	234
QGI81251.1|CE5	1.84e-166	1	234	1	234
CZS83092.1|CE5	5.34e-150	5	234	5	234
QPC60696.1|CE5	7.58e-150	5	234	5	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	6.01e-28	31	232	2	204	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	6.01e-28	31	232	2	204	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	6.01e-28	31	232	2	204	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	2.34e-27	31	234	2	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	2.56e-10	25	158	73	194	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	5.07e-29	15	232	11	231	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	4.37e-27	15	234	17	237	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	5.99e-21	26	232	21	227	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|B9U443|CUTI1_COPCI	1.62e-13	16	158	16	146	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1
sp|P9WP43|CULP1_MYCTU	1.10e-12	17	218	21	196	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999770	CS pos: 27-28. Pr: 0.4725

TMHMM  Annotations     

There is no transmembrane helices in FPRN_07091-t42_1-p1.