CAZyme Information: FPRN_07083-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_07083-t42_1-p1
• CAZy Family: GH141
• CAZyme Description: probable rhamnogalacturonase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	FCQG01000044|CGC1	57729.43	5.2868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000044:174421-176261(-)

Full Sequence      

MRHSFVSALIAVGSAVQAAAQLNGKVGPLTTASAKAAIKTCNIVDYGAKANAKTDNGLAI
QKAWNDCRTGGGEVYIPEGDYGMGTWVTLTSSKPMSFRLDGIIYRIGTDGGNMFMFKHLE
DFEFYSSTSKGAIQGYGYEFHKKNEYGPRILRFADVKSFSIHDVALVDSPAFHFSIDTCS
DGEVYNMAIHGGNRGGLDGIDVWGTNVHIHDVEVSNKDECVTVKNPSDHLLIENIFCNWS
GGCAMGSLATDTDIHDIEYRNIYTQRSNQMYMFKSYGGSGTVNNVALKNFAGHSNAYTLD
LDAQWSSMKPIAGDGILYTNMTFSGWSGTCADGHQRGPIKFNCPADVPCTDMQVDDFTVG
SNKGDTVEHVCKNAYGSGACLKEGDGGAYTTTQTVDAASAATPTMDGEIENGLGLTVSIA
IPTIRPSFFPGAAAISPRMADGAKAQATARVETSVPDEAETAANTSAAADVTVPVSTVTS
LATSAVTDEVTSLAIPTASVDALSSLIPEEHSSASTAVKASTTAKATETAAPLAKSPSCK
AKRRRSL

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	66	375	1.6e-47	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	4.12e-18	42	376	48	391	polygalacturonase
177865	PLN02218	1.54e-16	40	374	67	418	polygalacturonase ADPG
215426	PLN02793	8.65e-16	5	377	20	412	Probable polygalacturonase
165802	PLN02155	2.70e-14	42	376	29	380	polygalacturonase
395231	Glyco_hydro_28	7.62e-14	148	380	85	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI94855.1|GH28	0.0	1	547	1	547
QGI63973.1|GH28	0.0	1	547	1	547
CCT68019.1|GH28	0.0	1	547	1	547
QGI81242.1|GH28	0.0	1	547	1	547
QKD53836.1|GH28	0.0	1	547	1	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.69e-175	21	431	1	413	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	1.03e-14	48	373	23	373	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	1.05e-189	5	466	2	474	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	2.03e-179	21	437	19	438	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|B8NK45|RHGA_ASPFN	5.98e-179	3	454	2	458	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1
sp|Q2U293|RHGA_ASPOR	1.70e-178	3	454	2	458	Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	3.80e-177	21	437	19	438	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999670	CS pos: 18-19. Pr: 0.9816

TMHMM  Annotations     

There is no transmembrane helices in FPRN_07083-t42_1-p1.