CAZyme Information: FPRN_06738-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_06738-t42_1-p1
• CAZy Family: GH125
• CAZyme Description: probable pectate lyase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		33766.78	7.4379

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000002:526552-527718(+)

Full Sequence      

MRLLDILFFSSFSVAAPSAGLQARAAANDPCNIGYCTQNGGTTGGGSAAQVTVKTLAELT
AAAAADGPSVIFVQGSISGAAKVQVTSNKSIIGKTGSSLTGIGLTINGQKNVIVRNMKIS
KVEADYGDAITIQKSTNVWVDHCDLSAVRGDDKDFYDGLVDLSHAADWVTISYTYFHDHS
KGSLVGHSDKNAAEDVGTLRVTYANNHFNNVRSRGPLLRFGTAHIFNQYYDTMDTGLNSR
MGAQALIQSSVFTNVGKKAIFSESSSEVGYVVAEDVVLGGESQNTAPKGTLSSSKIPYQF
TLLGSGKVASTVPGQAGQKLSF

Enzyme Prediction     

EC	4.2.2.2:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	73	252	7.8e-86	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.13e-66	73	256	2	190	Amb_all domain.
226384	PelB	1.14e-49	70	317	78	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.39e-41	82	252	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61571.1|PL1_7	2.77e-221	1	322	1	322
QPC80187.1|PL1_7	6.83e-206	1	322	1	322
CAW62380.1|PL1_7	9.71e-206	1	322	1	322
CAX07511.1|PL1_7	9.71e-206	1	322	1	322
CAW97007.1|PL1_7	9.71e-206	1	322	1	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	8.34e-39	34	256	6	250	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	9.26e-33	25	230	1	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3ZSC_A	7.14e-30	41	256	20	230	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
2QY1_A	7.53e-25	33	270	3	263	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]
2QXZ_A	2.74e-24	82	270	67	263	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00645|PLYB_EMENI	8.71e-121	1	320	1	326	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1
sp|Q2TZY0|PLYB_ASPOR	6.69e-113	1	320	1	326	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|B8NBC2|PLYB_ASPFN	6.69e-113	1	320	1	326	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q0CBV0|PLYB_ASPTN	5.25e-112	1	320	1	325	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|O59939|PLYB_COLGL	2.75e-103	24	322	38	331	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999702	CS pos: 25-26. Pr: 0.9241

TMHMM  Annotations     

There is no transmembrane helices in FPRN_06738-t42_1-p1.